(data stored in ACNUC8465 zone)

EMBL: CP000828.PE412

CP000828.PE412       Location/Qualifiers
FT   CDS_pept        complement(427897..428370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0447"
FT                   /product="pentapeptide repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25503"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB13"
FT                   /protein_id="ABW25503.1"
FT                   /translation="MRLLVYDQSRDHFALNSIHLDRGEAMMTVMNRDDFVAQYASGKRD
FT                   FAGANLRGIALSEMDLSAVNFQDVYLAGADLESVDLGEANLQGSNLRGADLGGAFLQSA
FT                   NLKGADLRGANLMGADLREAELSDARLAAADYDRNTHFPTGFHPETAKMHLVS"
     atgcgactgc tggtctatga tcaaagtaga gatcactttg ccttgaactc gatccatcta        60
     gataggggtg aagccatgat gacagtgatg aatcgagatg attttgttgc ccaatacgct       120
     tcaggaaagc gagattttgc aggggctaat ttacgcggta ttgccctcag tgagatggat       180
     ttgagtgcag tgaacttcca agacgtctac ttggcagggg cagatctaga gtctgtggat       240
     ctgggcgaag ccaatttgca aggatctaac ctcagaggtg cagacttagg cggagctttt       300
     ttgcaaagtg ccaatctcaa aggagcggat ctacgagggg ctaatttgat gggggccgat       360
     ctgagagaag ctgaattaag cgatgctcgg ttagctgctg ccgattacga tcgcaacact       420
     catttcccca caggatttca ccccgaaacg gcgaagatgc atttagtctc ttag             474
//

If you have problems or comments...

PBIL Back to PBIL home page