(data stored in ACNUC27125 zone)

EMBL: CP000828.PE414

CP000828.PE414       Location/Qualifiers
FT   CDS_pept        complement(429778..430179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0449"
FT                   /product="rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25505"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB15"
FT                   /protein_id="ABW25505.1"
FT                   /translation="MTQVSPLAYTKLIPPPLLLDVRSVGEYRAEHIPNAINLSLLRLLI
FT                   GQLPIINRWVLPDWFQALSKDQPIVVVCLTSHRSPLAAAQLLKAGFTQVFNLSGGMQHW
FT                   RQCGFNTISGYPSGFTVTTPGHLGPKPNT"
     gtgactcagg tttcgccgtt ggcctacacc aaactcattc cacccccact gctactggat        60
     gttcgcagtg tcggagaata ccgagcagaa catatcccta atgccatcaa tctcagttta       120
     ttacgcctgc tcatcggcca actccccatc atcaaccggt gggtccttcc tgattggttt       180
     caagccttat ctaaggacca gcccatagta gtggtgtgtc taacatccca tcgtagtccc       240
     ctggcagcag cccaattgct caaggctggg ttcactcagg tattcaattt atcgggtggc       300
     atgcagcatt ggcgtcagtg cggtttcaac acgatttcgg gttatccatc tggctttaca       360
     gttacgactc caggacattt agggcccaaa cccaatactt aa                          402
//

If you have problems or comments...

PBIL Back to PBIL home page