(data stored in ACNUC27125 zone)

EMBL: CP000828.PE415

CP000828.PE415       Location/Qualifiers
FT   CDS_pept        complement(430261..431292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0450"
FT                   /product="rieske iron-sulfur (cyt b6f) fusion protein"
FT                   /note="Protein is a fusion of the Rieske protein from the
FT                   cyt b6f complex (PetC) and a conserved hypothetical protein
FT                   (COG3453)."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25506"
FT                   /db_xref="GOA:B0CB16"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR005939"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR014909"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR023960"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB16"
FT                   /protein_id="ABW25506.1"
FT                   /translation="MNESLSISQPSLSRRRFLNFLTGSAVAITAGATLYPISRVFVPPN
FT                   SSRGAGRVLAKDALGNPIPTSQLLAEPPGTRALVAGLDSEPTYLTLTITGQIEDRGIVD
FT                   NCTHLGCTFPWNGAADQFQCPCHGSRFAADGSVVRGPADRPLKLVHVQVEGEQIWILPW
FT                   TELDPRTGDRPWWVKADTFDDHPTPENLMQYTLQINEQLSVAMLQPTPDQIQDAAQLGF
FT                   KSVLNLRSPQEDGFLINESQLVHSAGMNYANLPINPADLSEATAEQVLTIIDQLSKPIL
FT                   LHCKGGLRSGAMALLYEAVHQQWTTDQLLAQVHKLDLPLAAHPQLLHFIQDYVDAQPLG
FT                   TVA"
     atgaacgaga gtttatctat ttctcagccc tctctctccc ggcgacggtt tctcaatttc        60
     ttgaccgggt cggcggtagc catcacggca ggtgcaaccc tctatcccat cagtcgtgtt       120
     tttgtacccc caaactccag cagaggggcg gggcgggttc tagcaaagga tgccctgggc       180
     aaccccatcc ccactagtca actcttggca gaaccgcctg gcactcgtgc cctcgtggca       240
     ggactagata gtgaaccgac ctatttaacc ctgacgatca caggtcaaat tgaggatcgg       300
     ggcatcgtcg ataactgcac ccatttaggc tgcacatttc cctggaatgg tgctgccgat       360
     caatttcaat gtccttgcca cggatctcgc tttgcagccg atggttccgt ggtgcgcggt       420
     cctgccgatc gacccctcaa gttggtgcat gtccaagttg aaggtgaaca aatctggatt       480
     ctgccttgga ccgagcttga cccacgcacc ggggaccgcc cctggtgggt caaggcggat       540
     acctttgatg accaccctac accggaaaat ctcatgcaat atacccttca aatcaatgag       600
     cagctctccg tcgctatgct ccagccaacc cctgaccaga ttcaagatgc ggcccaactg       660
     gggtttaagt ctgtattgaa tttgagatcg cctcaggaag acggctttct catcaatgag       720
     tcccaacttg tgcacagcgc aggcatgaac tatgccaatc tacccattaa tccagcagac       780
     ctctcagagg ccacggctga acaagtgttg acgatcatag atcagctatc caaacccatt       840
     ctcttgcatt gcaaaggagg gttacgctct ggtgcgatgg cattgctcta cgaagccgtt       900
     catcagcaat ggaccacaga ccagctattg gcccaagttc acaaactgga cctgccccta       960
     gccgcacacc cccaactgct gcactttatc caagactacg ttgacgccca acccctcggc      1020
     accgtggcct ag                                                          1032
//

If you have problems or comments...

PBIL Back to PBIL home page