(data stored in ACNUC27125 zone)

EMBL: CP000828.PE419

CP000828.PE419       Location/Qualifiers
FT   CDS_pept        433712..434902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0454"
FT                   /product="efflux transporter, RND family, MFP subunit
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25510"
FT                   /db_xref="GOA:B0CB20"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB20"
FT                   /protein_id="ABW25510.1"
FT                   /translation="MVVKTAIATRQPIAIDRILTGTVESSEAVTLTSRVMGQIRQLTVR
FT                   EGDIVQAGQRIAEIDVRDIQAQQQQATAAIPQAQSAVSIAHSAKLTAQAQKSQAQARVQ
FT                   EAQAQLTEAQAELADAQLHQQRMVMLRREGAVSQSRLDEANTRLSVIQARISQAKAGLT
FT                   QSRTTVRQAQAAVVQAQAQIRQAQAQVEQAQAQVKQTQANLDYGTVIAPFTGVIRHKYT
FT                   EVGAMAGPGESIVKLERSGHLRLSVDAPESLVGQIQRGKSVLVQIDALNRQIAGRINQI
FT                   IPAADPRSRNFTVKIALKPNQDLLPGMFGRLQFSSITRQNAAARQGLMIPEDAIVKQFG
FT                   ITGVFKVVGQQAQFNPITTGQIEGKTVEVYSGLERGDRIIVNPSPKLENGTALQVS"
     atggtcgtga agactgcgat cgcaactcgg caacccatag ccatagatcg gatccttaca        60
     ggcaccgttg aatcatctga agcggtcact ctgaccagtc gagtcatggg ccaaattcgg       120
     cagctgacgg tgcgcgaagg agatatcgtt caagcgggac aacggatcgc tgaaatcgat       180
     gtccgcgata ttcaagccca acagcagcaa gcaactgcgg cgattcctca agcgcaatca       240
     gcagtcagta ttgcccactc agcgaaactg accgcccaag cgcaaaaaag tcaggcccaa       300
     gctcgtgtcc aagaggctca agctcaactg accgaagcgc aagccgaact cgcagatgcc       360
     caactccatc aacaaaggat ggtgatgcta aggcgagaag gagcggtgag ccaatctcgt       420
     ttggatgagg cgaatacgcg cttgtcggtg attcaggctc gtatcagtca agcgaaagcc       480
     ggactgactc aatcccgcac gacggtgagg caagcccagg ctgccgtggt tcaggcccaa       540
     gctcaaatcc gtcaagctca agcccaagtt gaacaagctc aggctcaagt gaaacaaact       600
     caagccaacc ttgactatgg gactgtgatt gcccccttca caggcgtgat caggcataaa       660
     tacaccgaag tgggggcaat ggcaggtccc ggcgaatcaa ttgtgaagtt agaacgcagc       720
     ggtcatctga gactgagtgt tgatgctcct gaatctctgg taggccaaat tcaacgaggc       780
     aaatccgtct tagttcaaat cgacgcgctt aatcgccaga tcgcaggccg cattaatcaa       840
     atcatccctg ctgctgatcc cagatctcga aacttcaccg ttaagatcgc cttgaagcca       900
     aaccaagact tgctaccagg catgtttggt cgattacagt tcagctccat tactcgtcaa       960
     aatgctgctg ctcgccaggg tctcatgatt cctgaagatg cgatagtcaa gcaatttggc      1020
     atcacagggg tcttcaaagt cgtaggccag caggctcagt ttaatcctat taccacggga      1080
     cagattgagg gcaaaacagt ggaggtctat tcaggactag agaggggaga tcgcatcatt      1140
     gtcaatccca gccccaaact tgagaacgga acggctcttc aagtgagtta g               1191
//

If you have problems or comments...

PBIL Back to PBIL home page