(data stored in ACNUC5340 zone)

EMBL: CP000828.PE420

CP000828.PE420       Location/Qualifiers
FT   CDS_pept        435182..435634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0455"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25511"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB21"
FT                   /protein_id="ABW25511.1"
FT                   /translation="MKWIHLFISIALLTSTIFMAPAYAQNTSSDSASVNTVSIRRPRHF
FT                   NPAIVETLSGKIVRVDRVASPGRRSGKGVHLSLQTSEETVDVHLGPSWYLDEQQLNLKS
FT                   GDPVEVTGSRVTDASPPAIIATQVKSGDTVLNLRDESGQPTWRGME"
     atgaagtgga ttcatttgtt catatcgatt gccctgttga ctagcacgat atttatggct        60
     ccagcctatg cccaaaacac gtcctccgac tctgcttctg tcaatactgt cagcatccga       120
     agacctcggc acttcaaccc cgccattgtt gaaactctca gtggcaaaat tgttcgggtt       180
     gatcgggttg ctagtccagg tcgtcgatct ggaaaggggg tacatttatc tctgcaaacg       240
     tctgaagaaa ctgtggatgt tcatttagga ccctcctggt atctggatga acagcaattg       300
     aatctcaaat ctggcgatcc ggtcgaagtc actggctccc gagtcactga tgccagcccg       360
     cccgcgatca ttgccaccca agtgaaatca ggggataccg ttctcaacct cagagatgaa       420
     agcggtcagc ctacctggag aggtatggag tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page