(data stored in ACNUC5340 zone)

EMBL: CP000828.PE421

CP000828.PE421       Location/Qualifiers
FT   CDS_pept        435682..436089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0456"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25512"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB22"
FT                   /protein_id="ABW25512.1"
FT                   /translation="MSDLFSPTWMQAYLNQWNAEPELASALATIHFNSTIAYGFKDVAM
FT                   PKGVLTSENGRAIKAKPYIDQPLNWDLRATPEDWQKWQSNGLSMMGLSMAYMSGKLKFE
FT                   VGDYTSIIKDPRMVGPFLMSFSVMGRVLSHA"
     atgagcgacc ttttttcccc tacatggatg caggcttatc tcaatcaatg gaatgctgaa        60
     cccgaactgg cctctgcctt agcaaccatt cattttaatt ccacaattgc ttatgggttt       120
     aaggatgtag ctatgcccaa aggggtgttg actagcgaaa atggacgggc gatcaaagcc       180
     aagccttaca tcgatcaacc tttgaactgg gacttgcgag ccactccaga agactggcaa       240
     aaatggcaat ccaatggctt aagcatgatg gggctaagca tggcctatat gagcggcaag       300
     ctcaagtttg aggtgggcga ttatacctca atcattaaag atccacgtat ggtggggcct       360
     ttcctgatgt ctttctctgt tatgggtcgg gtattgagcc acgcctaa                    408
//

If you have problems or comments...

PBIL Back to PBIL home page