(data stored in ACNUC27125 zone)

EMBL: CP000828.PE429

CP000828.PE429       Location/Qualifiers
FT   CDS_pept        441778..442494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0464"
FT                   /product="pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25520"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B0CB30"
FT                   /protein_id="ABW25520.1"
FT                   /translation="MQSLNQLMESYAAGQRDFAHSQLLEAEIVKADLAGIDLSRADLRQ
FT                   ARLGRTNFSHGTFREADLSEALLWGADLSGADLSSAVLREADLSGAKLVQVNLAKANLY
FT                   KASLCGTNLRQANLTETILYEVDLRPSLDQGTDLGEADLTNAELNYAHLSGATLAHAIL
FT                   VGAKLCRANLSQQGWGGQVPTDLRGADLQQADLSYADLRGAWLQEANLRRADLTGTDLG
FT                   GAQLTGAIMPDGRTYT"
     atgcagtccc ttaaccagct gatggagtcc tatgctgccg gacagcgaga ctttgcccac        60
     agccaacttc tcgaagcaga aattgtgaag gctgatttgg caggtattga tctgagtcgg       120
     gcggatctgc ggcaagctcg gcttggacgt accaatttca gtcatggaac gtttagggag       180
     gcagatttaa gtgaagccct gctatggggg gcggatttaa gcggggccga tcttagcagc       240
     gcagtattgc gcgaagctga tttgagtggg gctaaattag tccaggttaa tctggccaag       300
     gccaacctct acaaagccag cctgtgtggg actaatctaa ggcaggccaa tctcacggag       360
     accattttgt atgaggtgga tttaagacct tccttggatc agggaaccga tttgggggag       420
     gccgatctga ccaatgcgga gttgaattat gcccatctga gtggggcaac gttggcccac       480
     gctatcttag tgggggctaa actttgccgc gcaaacttga gtcagcaagg atggggggga       540
     caggtgccga cggatttaag gggagctgac ctccaacagg ctgatttgag ctatgcagat       600
     ttgcgtggtg cttggttaca agaggccaac ctccgccgag cggatttaac ggggaccgat       660
     ttagggggtg cccaattgac aggggccatt atgccggatg ggcggactta tacctaa          717
//

If you have problems or comments...

PBIL Back to PBIL home page