(data stored in ACNUC27125 zone)

EMBL: CP000828.PE434

CP000828.PE434       Location/Qualifiers
FT   CDS_pept        447139..449445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0469"
FT                   /product="two-component hybrid histidine kinase sensor and
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25525"
FT                   /db_xref="GOA:B0CBY3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBY3"
FT                   /protein_id="ABW25525.1"
FT                   /translation="MTEDFVTSSPQHSQSWQQAILDSADFVIVSTDINGLIQTLNAGAL
FT                   KQFGYSPEEIIDRVTPIIFHDPEEVEQRAQVLSHELGHAIEPGMETLIVKARMGMVDEN
FT                   IWTLIRKDHSRFPVRLSVTALRNDLGHLTGFLGIGKDITAQQAAEASLVESEARFSAAF
FT                   QNAPIGMALVSPSGQCLRVNHALAHLLGYPQTKLMDLILTEMIHPKDRSIEETNRLRLV
FT                   AREIGNYCLELRCLHQQGHEVWVLMNVSLVNGQEVYPPYCIVQVQDITRRKQAEAQLQR
FT                   LNANLEQLVEERTRQLKEAIETTEIANQAKSRFIANMSHEFRTPLNGIMGFSQLLLQDR
FT                   RITSDQQSNLNVILRSGEHLLSLVNEVITLSKIEAGMLAYESKDVNLHHLCEGVEDLLS
FT                   LQANSKDIQFQIHIAPDVPQYVRTDAKKLRQILINLLGNALKFTKRGSVVCQVQWRPSA
FT                   PERSAHELHFIIQDTGPGIPGHLLPQLFEPFAQDPLNRETFGGIGLGLTICQRFIHLMK
FT                   GDISIESVEGQGTTVSFYIQVESGEPVLEPAISETTVEGLAENTPSYRVLVVEDYPDNR
FT                   EILLMMLEVVGFEVKEAVNGQEAVDLNRTWQPHLIWMDLQLPVLNGLEATQLIKSQNPN
FT                   PPVIIAITAQALESDEVKALKAGCDDYLRKPYQAAQVFEKMAQHLDITYRYKTSNSSHT
FT                   SADPISLSADELANMPPSWIQLLYDAAIMLDEDMLDLLLRDIPDDQHSLKSSLEYLMAT
FT                   YQYDVIMEKAQAVLR"
     atgactgaag actttgtaac ctcatcgcct cagcattcac agtcctggca gcaagccatt        60
     ctagatagtg ccgatttcgt tattgtttca acagatatta atgggttaat tcaaacccta       120
     aatgcaggag cattaaaaca atttggctat tcacctgagg aaatcattga tagagtcacc       180
     ccaatcatct ttcatgaccc agaagaagtc gagcagcggg cgcaagtcct ctcccatgag       240
     ttgggccatg ccattgaacc aggtatggag acccttatcg tcaaagcacg tatggggatg       300
     gtcgatgaaa atatctggac cttgattcgc aaagatcaca gtcggttccc cgttcgctta       360
     tctgttacag cacttaggaa tgatttaggc catttaacag ggtttctcgg gattggcaaa       420
     gatattactg cgcaacaagc tgctgaagcc tctctagtcg aaagcgaagc gcgattctca       480
     gccgcgtttc aaaatgctcc tataggcatg gctttagtgt ctcccagtgg tcagtgccta       540
     agagtgaatc atgccctagc tcatttactg ggatatcccc aaaccaaact gatggatctc       600
     atcctcactg agatgatcca tcccaaagat cgatccatag aagaaacgaa ccgactacga       660
     cttgttgcaa gagagattgg caactactgc ttagagctac gctgtcttca tcagcagggg       720
     catgaggtat gggttttgat gaatgtatct ctggtcaatg gccaagaggt ttaccctccc       780
     tactgcattg tccaagtaca agatattacc aggcgcaaac aagcagaagc acaactccag       840
     cgcctcaacg ccaatctgga gcaactggtt gaggaacgga ctcgccaact caaagaagcg       900
     attgaaacca ctgaaatcgc caatcaagcc aaaagccgat ttatcgccaa tatgagccat       960
     gagtttcgca cgcctctcaa cggcatcatg ggttttagtc aactcttgct tcaagatcgt      1020
     cgcattacgt cagatcagca atctaacctc aatgtcatcc ttcgcagtgg tgagcactta      1080
     ctctcgctgg tcaacgaagt cattaccctc tccaagattg aagcaggaat gcttgcctat      1140
     gagtccaaag atgtcaatct gcaccatctt tgtgaggggg tggaagactt attatcccta      1200
     caggcgaatt ccaaagacat tcagtttcaa attcatatcg ctcctgacgt tccccaatac      1260
     gtgagaacag atgctaaaaa actacggcaa atcttgatta acttactggg taatgccttg      1320
     aagtttacga aacgaggcag tgtcgtgtgt caggtgcagt ggcggccttc ggcaccggag      1380
     cgctctgccc atgaattaca tttcatcatt caagatacag gtccagggat tcctgggcat      1440
     ttactacctc aactttttga accctttgct caagacccgt tgaatcgtga gacatttggt      1500
     ggcattggct tggggctaac catttgccaa agatttatcc atctgatgaa gggggacatt      1560
     tccattgaga gtgttgaggg gcaaggaaca accgttagtt tttacattca agttgaatca      1620
     ggtgagcctg ttctagaacc agcaatatct gagacaaccg ttgagggtct tgcagagaat      1680
     actccctcct atcgcgtttt agtcgtagaa gattatcctg ataaccgcga gattttgctc      1740
     atgatgcttg aagtagtggg gtttgaggtc aaagaggctg tgaatggcca agaggcagtg      1800
     gaccttaacc gaacatggca accccattta atttggatgg atttacagct gcctgtatta      1860
     aatggcctgg aggctactca attaatcaaa tcccagaatc caaatccacc tgtcatcatt      1920
     gccatcaccg cccaggcgct ggaatctgac gaagtgaaag cgctcaaagc tgggtgcgat      1980
     gactatcttc gtaaacccta tcaagccgct caagtttttg agaaaatggc tcaacattta      2040
     gatatcacct atcgttataa aacgtccaat tcatctcata cttcagcaga tccgatttct      2100
     ctctcggcag atgagttagc caacatgccc ccttcctgga tacagcttct gtatgatgct      2160
     gccattatgt tggatgaaga tatgcttgat ctcttgctta gagacattcc tgatgaccag      2220
     cactccctta aatcttcttt ggagtatcta atggccactt atcaatatga cgtcattatg      2280
     gagaaggctc aagcggtttt gagatag                                          2307
//

If you have problems or comments...

PBIL Back to PBIL home page