(data stored in ACNUC5340 zone)

EMBL: CP000828.PE435

CP000828.PE435       Location/Qualifiers
FT   CDS_pept        complement(449589..449732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25526"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBY4"
FT                   /protein_id="ABW25526.1"
FT                   /translation="MQVAVVSIQTAIFFGAVAGSHAISKSRSIIIMSQTDIEESLNVLP
FT                   GR"
     atgcaagtgg ctgtcgtcag catccaaaca gcaatcttct ttggagctgt ggctggatct        60
     catgccatat ccaaaagcag atccatcata attatgtctc aaacggacat tgaggaaagt       120
     ctcaacgttt taccaggccg ctag                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page