(data stored in ACNUC8465 zone)

EMBL: CP000828.PE436

CP000828.PE436       Location/Qualifiers
FT   CDS_pept        450176..453400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0471"
FT                   /product="AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25527"
FT                   /db_xref="GOA:B0CBY5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBY5"
FT                   /protein_id="ABW25527.1"
FT                   /translation="MVHSSVVAPSHKLSLVGRITAYFINSQVTVLLIAALVLFGVGAAV
FT                   FTPQEENPQIVVPAAEVILPYPGVSAEVVENMVTNPIEAKLRELTGVEHLYSVSQNSGA
FT                   KITVQYFVGEDWEDSLFKLQNHLYNHQDLLPPEASYLVKPVIIDDVPIVTLTLTGKGYT
FT                   DNQLRRVGERLLNDLRSIPDTANLTMVGGKPRAIRVDLDPDKLASYRLSPAQISQQLQV
FT                   ENVQLPTGDVSVGETRLFLEGGNLFQSAADVGEIMVGFGTATDQGHPRPIYLKDVAAVV
FT                   DDFGDLTTVSRIHYRPDWDIANPYPDPSSQAQGEFITQPAMTIGIAKKKGTNAVTVAQQ
FT                   IFDRVDDLQSQLPPGVQIAVTRNDGQTAARAVGDLYQSLLIAIATVVGLLVMFLGWREA
FT                   AIVAFVIPLTLAGTLAVGWLAGQTINRITLFALILALGTLVDDAIAVTENIHRHFESVL
FT                   PSDRRQKTAAAISAVNELGTPILLSTITVILAFLPMRFVTGMMGPYMGPIPFNVPVAML
FT                   ISTTLAVTVTPFLALRLIQLQPHSKTLPSIQQTRIYRGYRWVMAPLLDSASRRRFVLLG
FT                   VTGLLLATMILPLTQAVRFRMLPKADKDTFLVQVDAPLGTELATTNHLVEDLEAVLQQE
FT                   TDITHFETYVGTGSPLDFNGMLRGATDRQAEHFADIRVHLTNKDARSRQSEAIVFALRP
FT                   QLEQMATRHNALVKLVEDPPGPPVRSTMLAEVYGPDYGQLRALAKQVRQVFAQTDAVVD
FT                   IDDSVKNQMPQMRLVVDREKAQRARLATQEIAQTLRVAIAGAQVSTLKVADELSPVGIQ
FT                   VRFADANRQSMDDLHRIQLPTANDALVSLSELVQFQPTTVDQPIFHKDQRAVSYVMGEM
FT                   GDRSSVYAVIDQLVYFWRHPLPQGYWIQWDGEWKLTLDVFRDLGLAMLVAVLLIYLILV
FT                   GQFRSFKVPLIILGSIPLALIGILIGFSLNGVYFSATAMIGVIALAGIVVRNAIVLLEF
FT                   VGDKLREGTDLKLAILEAGATRFRPILLTSVTTMLGTLSILSDPVWSGLAWTLLSGMLA
FT                   SSLLTLVVIPLMYYGECRNPDSLTNP"
     atggtccact cctctgttgt tgctccgtcg cataaattga gccttgtggg tcggattacg        60
     gcttacttta tcaactctca agtgacggtt ttgctgattg ctgcccttgt tctgtttgga       120
     gttggggcag ccgtcttcac cccgcaagaa gaaaatcctc aaattgtggt tccagcggct       180
     gaggttatcc tgccttatcc cggtgtttct gcggaggtgg tagagaatat ggtcactaac       240
     cccatagagg ctaagttgcg agaactcaca ggagtggagc atctctattc cgtctcccaa       300
     aactcagggg ccaaaattac tgtgcagtat tttgtggggg aagactggga agattctctc       360
     ttcaaactgc aaaatcatct ctacaatcat caagatctac tgcccccaga ggcgtcctat       420
     ctcgtcaaac cagtgattat cgatgatgtt cctattgtga ccctgacgtt gacagggaaa       480
     ggctataccg ataaccagct tcgtcgagtg ggagagcgac ttctcaatga tttacgtagt       540
     attccagaca ccgccaattt gacgatggtg ggtgggaaac cccgtgccat tcgggtggac       600
     ttggaccccg ataaactggc tagttatcgc ctctcccctg ctcagattag tcagcaactc       660
     caggtggaga atgtccaact gcccacgggg gatgtatctg ttggagaaac ccgcctattt       720
     ttagaagggg gcaatctgtt tcagtctgcc gcagatgtgg gggagattat ggtgggcttt       780
     ggcactgcca cggatcaggg ccatccccgt cccatttacc tcaaagatgt ggcggcggtc       840
     gtggatgatt ttggcgatct caccacggta tcgcgaattc attatcgacc agactgggat       900
     attgccaatc cctatccaga ccccagcagt caggctcaag gggaatttat cacccagcct       960
     gcgatgacga ttggaatcgc taagaaaaaa ggcacgaatg cggttaccgt tgcccagcag      1020
     atttttgatc gagtggatga tctccaatcc caactgccac cgggggtgca aattgccgtt      1080
     acccggaatg atggtcagac cgctgccagg gccgtcggcg atctctacca aagtttgctg      1140
     atcgccattg ccactgtcgt ggggctactt gtgatgttcc tggggtggcg ggaagctgcc      1200
     attgtcgcct ttgtgattcc cctgacctta gcggggacac tagccgtagg ctggttagcg      1260
     ggacagacga ttaatcgtat taccctgttt gccctgatct tggccttggg gacgttggtg      1320
     gatgatgcga tcgcagttac cgagaatatt caccgccact ttgaatctgt gctgccatct      1380
     gaccgacggc agaaaacggc tgccgccatt agcgctgtta atgaactggg caccccgatc      1440
     ctgttatcga caatcaccgt tatattggcc ttcttaccga tgagatttgt gacgggaatg      1500
     atgggaccat atatgggacc gattcccttt aatgtgccgg tggcgatgct gattagcaca      1560
     accctagccg taacggtgac gcctttttta gccctacgtt taattcagct acagccccac      1620
     tcaaagacat tgcccagtat tcaacagacc cgcatttatc gcggctatcg ctgggtgatg      1680
     gctcccctcc ttgactccgc gtcccgacga cgatttgtat tgctgggggt gacgggatta      1740
     ctcttagcaa caatgatctt acccctgact caggcggtgc ggtttcggat gctgccgaaa      1800
     gccgataaag ataccttcct ggtgcaagta gatgccccct tggggacgga gttagcgacc      1860
     accaatcacc tggttgaaga tttagaggct gtcctccaac aagagactga cattactcat      1920
     tttgaaacct atgtcggtac ggggtcaccc cttgacttca atgggatgct gcgaggagcc      1980
     acagatcgcc aagccgaaca ttttgccgat atccgggtcc atctcacgaa taaagacgct      2040
     cgatcgcgcc aatcagaagc cattgtcttt gccctgcgtc cccagttaga acagatggcg      2100
     acacgccata atgccctcgt caagctcgtg gaagatcccc ctggtcctcc ggttcgctca      2160
     acgatgttgg cggaagtgta tggtcctgac tatgggcaac tgcgggcatt agccaagcaa      2220
     gtgcgacaag tctttgccca aactgatgcc gtggtggata ttgacgattc agttaaaaat      2280
     caaatgcccc aaatgcgact ggtcgtggat cgagagaaag cccagcgagc aagattggca      2340
     acccaagaga ttgctcagac gttacgggtt gcgatcgcag gtgcccaagt ctccaccctg      2400
     aaagttgccg atgaactgag tcccgtcggc atccaagtcc gctttgcaga tgccaatcgc      2460
     cagagtatgg atgacctgca tcggattcaa ctgcccactg ccaacgacgc tttagtgtcc      2520
     ctctcagaac tggtgcagtt tcaacctacc accgtcgatc aacctatttt ccataaggat      2580
     cagcgggccg tcagctatgt gatgggggaa atgggcgatc gatcgtctgt gtatgctgtc      2640
     atcgatcaat tggtctactt ttggcggcat cctttacccc agggttattg gattcagtgg      2700
     gatggtgaat ggaagcttac cctggatgtg tttagagatt taggcttagc catgctggtg      2760
     gcagtcctac tgatttatct gattctcgtc ggtcagtttc gcagctttaa ggtgcccttg      2820
     attattctgg gcagcattcc tctcgcctta attggaattt tgattggttt ttccctcaac      2880
     ggcgtctact tcagtgccac agccatgatt ggggtgattg ccttagcggg aatcgtcgtc      2940
     cgcaatgcca tcgtcttgct agagttcgtg ggggataaat tgcgagaagg gactgacttg      3000
     aagctggcta ttctcgaagc aggggcgact cgttttcgcc ccatccttct cacgagtgtc      3060
     actacgatgt taggcaccct ctccatcctc agcgatccag tttggtcggg attagcttgg      3120
     acactactta gtggaatgct agcgtcatcc ctgctgacct tagttgtgat tccactcatg      3180
     tactacggtg aatgtcggaa tcctgatagt ctcaccaacc cataa                      3225
//

If you have problems or comments...

PBIL Back to PBIL home page