(data stored in ACNUC27125 zone)

EMBL: CP000828.PE437

CP000828.PE437       Location/Qualifiers
FT   CDS_pept        complement(453563..453907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0472"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25528"
FT                   /db_xref="InterPro:IPR015102"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBY6"
FT                   /protein_id="ABW25528.1"
FT                   /translation="MILQDVQDFIHNGHLVSLAEMEQHFHIEGQALQAMIHKLIRKGRV
FT                   RQAPVPTKCHGCTFCDGHALTFYEWVDEQNRPEPHHGSRCSIPCCQDQPIHSLEPELFN
FT                   QYGSTSKKFG"
     atgattttgc aggacgttca agactttatc cataacggtc atctggtttc tctggccgag        60
     atggagcaac atttccatat tgaaggccaa gccctacagg cgatgatcca taaactgatt       120
     cgtaagggtc gggtgcggca agcccctgtt cctacaaaat gtcatggctg taccttttgt       180
     gatggtcatg ccctgacgtt ttatgaatgg gtagatgagc aaaatcgccc tgaaccgcat       240
     catgggtccc gatgctctat tccctgctgc caagatcaac ccatccatag cttagaacct       300
     gagcttttca atcagtacgg ttcaacgtca aagaaatttg ggtga                       345
//

If you have problems or comments...

PBIL Back to PBIL home page