(data stored in ACNUC27125 zone)

EMBL: CP000828.PE440

CP000828.PE440       Location/Qualifiers
FT   CDS_pept        complement(458313..458720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0477"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25531"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBY9"
FT                   /protein_id="ABW25531.1"
FT                   /translation="MKYSPDEIRKAAIAIQPYIAELLDAPNAQRLERQLEGLLSQSSLK
FT                   QGSHTQLSHLLAEHESTQDWIRLYLEEQYPAEDILKALRVYYPLPGIENSVESPRYICP
FT                   VEKCNQDWYRKNREDEIPVCPVHGLKLIIDS"
     atgaaatatt cacctgatga gatccgtaaa gcagctatag caatccagcc atatatagca        60
     gaacttcttg atgctccaaa cgctcagcga ctagagagac agctagaagg gttactgtcc       120
     cagtcttcac taaaacaagg cagccatact caactctccc atcttttagc agagcatgaa       180
     tcaacccaag attggatccg gttatatctg gaggaacaat atcctgctga agatattctc       240
     aaggctctca gagtttatta tccccttcca ggaatcgaga attccgttga aagtcctcga       300
     tatatctgtc cggtcgaaaa atgcaaccag gattggtatc gcaagaatcg ggaagatgaa       360
     attcctgttt gcccagtcca tggcttaaaa ctcattatcg atagctag                    408
//

If you have problems or comments...

PBIL Back to PBIL home page