(data stored in ACNUC5340 zone)

EMBL: CP000828.PE443

CP000828.PE443       Location/Qualifiers
FT   CDS_pept        complement(460374..461066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0480"
FT                   /product="cyclic nucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25534"
FT                   /db_xref="GOA:B0CBZ2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBZ2"
FT                   /protein_id="ABW25534.1"
FT                   /translation="MIDTANVADWLEITVIFRGLSAEQRQALTQIAQIQSFKKGEQIFR
FT                   QDQEATGFYVVKSGRVKVFQMSANGKEQILNIFTEGDNFADVPALDGQAFPASAAALEP
FT                   ADLIFFPRYPFLEFLHHNPDVAVQMLISLSSHLRHLAQLVEQLSFKSVPQRLATYLLSL
FT                   GDTASDTVYLDLTKSQLAARLGTIPATLSRAFYQLSSDGMIAIAGPKVTILDRDRLTAL
FT                   SQSPESSE"
     atgatagaca ccgctaacgt ggcagattgg ttggagataa ccgtgatttt tcgcggctta        60
     tccgcagaac aacgccaggc cctgacccaa attgctcaaa ttcaatcctt taagaagggt       120
     gagcaaatct tccgccaaga ccaagaagcg acgggatttt atgtggtgaa gtcggggcga       180
     gtcaaagtct ttcagatgtc tgccaatggc aaagagcaaa ttttgaatat ttttaccgag       240
     ggggataact ttgcagatgt ccctgcttta gatggccaag cctttccggc ttccgctgca       300
     gccctagaac ctgcagacct aatttttttc ccgcgctacc cgtttctgga gtttctccac       360
     cacaaccccg atgtggcggt gcaaatgttg attagcctct ctagccacct gcgccatctg       420
     gcccaactgg ttgagcaatt gtcatttaaa agtgtgccgc agcgtttggc aacctacctg       480
     ttaagtttgg gtgatacggc cagcgatacg gtctatctgg acttaaccaa aagccaactg       540
     gcagcaaggc tgggaactat tccagcgacc ctgtctcggg cgttttatca actgagtagt       600
     gatggcatga ttgcgatcgc aggtcccaaa gtaacgatac tggatcgcga tcgcctcaca       660
     gcattaagtc aatccccaga atcctccgaa tag                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page