(data stored in ACNUC5340 zone)

EMBL: CP000828.PE447

CP000828.PE447       Location/Qualifiers
FT   CDS_pept        464993..465439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25538"
FT                   /db_xref="GOA:B0CBZ6"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="UniProtKB/TrEMBL:B0CBZ6"
FT                   /protein_id="ABW25538.1"
FT                   /translation="MLFKLLVILHTLGATVWTGGHLVLAVTVLPLAMQNRDPDRIHTFE
FT                   EHFEGFGLAALLLQTITGVWLTWIYFPGFQNFLAFQSYLSIYIVIKLSLLLSTLALALY
FT                   ARFFIIPKLTQETLNELAFHIIGVTTLAVLFVVMGVGIRLGSLS"
     atgctattca aactcctagt tattctgcat acattgggtg caacagtttg gacgggtggg        60
     catttggttc tggcagttac ggtgttgcct ttggccatgc aaaatcgcga tccagatcgc       120
     atccatacct ttgaagagca ctttgaagga tttggccttg cggcattgct gcttcagacg       180
     attactgggg tgtggctgac ctggatttat ttccccggct tccagaactt cttggctttc       240
     cagtcctatc tatcgatcta cattgtcatc aagctatcct tacttctgag cacattggcc       300
     ctcgcccttt atgctcgctt ttttatcatt ccgaagctga cccaagagac cttgaatgag       360
     ctggcctttc acattattgg tgtcactacc ctagctgtat tattcgtggt gatgggggta       420
     ggtattcggt tgggcagttt gagctaa                                           447
//

If you have problems or comments...

PBIL Back to PBIL home page