(data stored in ACNUC27125 zone)

EMBL: CP000828.PE45

CP000828.PE45        Location/Qualifiers
FT   CDS_pept        47266..49698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0048"
FT                   /product="GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25136"
FT                   /db_xref="GOA:B0C524"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR016132"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B0C524"
FT                   /protein_id="ABW25136.1"
FT                   /translation="MTPSSLPPSKPEQSEPEQIEFSSLSPSEISIDQPKTKNTGANQEY
FT                   LTSIKARLIAWGIALSTLPVLAVGTATYLTGETLNQQLSANPEITTSWDEAQSTLQNRI
FT                   PPLLVGTGIVAILSGGLAVWLINRELRPLRQAGRHSNQLVNRLYRLETGPEIESEPKDE
FT                   LLALANNISLIDAQIPNLIHSQEHEAARAELLMQFIGELHVALSEEDLLKTTVAEVRQI
FT                   LQTDRVTIFALNNNGEGTFVAESVAPGYPKLQWSTLHDPCFNEGYQEQYRQGRVSAIDN
FT                   IYNSGLNDCHIGLLERFAVKANIVAPILQNENLYGLLIAHQCARPREWNQSEIGLFKQL
FT                   ALQVGYALDRARVMSHLDSQVNQLQQLLHFTQLIRESLHTEEILTNAVQESRKVLRADR
FT                   VIVYSFDENWQGTVAAEAVQPGISKMVWAEISDPCFANKYVEQYRRGRVQAINNVNDAG
FT                   LTECHVQQLEKYGVQANLVVPILVGEYLFGLLIAHQCSGPRIWQSSEIDLFTQIGVQLG
FT                   HALEQANVLTQTEQEWIANTSQIDIDNQQLTNLEQQLSDYLQANRPSIQFLVDGVHQHT
FT                   ETAQSAYSHLQAIMDFAQEVNTLTRQIQSQNHQIVTQVEIAQNHPPHLPPAAQSAITQL
FT                   QELEKPLQQLSQIRILVNQLSSQMQLQVMNITAKAPQDSEAYPELSGSAQKISIVAQKI
FT                   EDNLAQMKPILESLQRDLQQNTAILKPLAQQTSTVSTERFRSEQLSSNLNTELAQLNDQ
FT                   MKKLTQLVSSHLQTSSTASHQIFELNQFLQRLAPQAQSMQASIQKMETAVTPEQSPG"
     gtgacgccgt catctcttcc accatccaaa cccgaacaat ccgaacccga acagatagaa        60
     ttttcgtctt tatccccttc agaaatctcc atcgatcaac ccaaaacaaa aaatactggt       120
     gcgaaccaag agtatctaac ctccatcaaa gccagattaa tcgcttgggg aattgccttg       180
     agtacattac ctgtcttagc tgtaggcaca gcaacctacc tgaccggtga aacactgaac       240
     cagcagctca gcgccaatcc cgaaatcacc accagctggg atgaagccca atccacgctt       300
     caaaatcgaa ttccccctct attggtaggg actggaatcg tggcaatcct gtcggggggc       360
     cttgccgttt ggttgatcaa tcgtgaatta cgtccccttc gtcaagctgg tcggcattca       420
     aatcaactcg ttaaccggtt gtatcgctta gaaacaggtc ctgaaatcga gagtgaaccc       480
     aaagatgagc ttttagcgct ggccaacaat atcagcctaa tcgatgctca aatccccaac       540
     ctgatccatt ctcaagaaca tgaagcggct cgagcagaac tattgatgca gttcattggt       600
     gaactccatg tcgctctatc agaagaagac ttattaaaaa cgaccgtcgc cgaagtgcgc       660
     caaatcttac aaaccgatcg agtcaccatc tttgccctca acaataacgg tgagggtacc       720
     tttgtcgccg aatctgttgc cccaggttat cccaagttac agtggtctac cctacatgac       780
     ccttgcttta acgaaggcta tcaggagcaa tatcgtcagg gacgagtcag tgcaattgac       840
     aatatttaca attcaggact gaacgactgt catatcggtt tgctagagcg ttttgccgtc       900
     aaagcaaaca ttgtcgctcc cattctccaa aacgagaatt tgtatggcct gttaatagcc       960
     catcaatgtg caagacccag ggagtggaat caatctgaaa tcggcctgtt taagcaatta      1020
     gcattgcaag taggctatgc cttagaccgg gctagagtca tgagccatct cgatagccaa      1080
     gtcaatcaat tgcagcagtt attacacttt acgcaattaa tccgagaatc attacacaca      1140
     gaagaaatcc tgacaaatgc ggttcaagag agtcgcaagg ttcttagagc agatcgggtg      1200
     attgtttata gtttcgatga aaactggcaa ggcactgttg cagcagaagc agtccagcca      1260
     ggtatctcca aaatggtgtg ggccgaaatc tcagacccat gctttgcaaa caaatacgtt      1320
     gagcaatatc gacggggacg agtgcaggcg attaataatg ttaatgatgc tggactgact      1380
     gagtgccatg ttcaacagtt ggaaaaatac ggcgtacaag ccaacttagt tgttcctatt      1440
     ctggtgggag aatatttgtt tggtttactc attgcccatc aatgctctgg ccccagaata      1500
     tggcagtcct ctgaaatcga tctttttact caaattggcg tccaattggg ccatgcgttg      1560
     gaacaagcca acgttctcac ccaaacagag caagaatgga ttgccaatac ctctcaaatt      1620
     gatatagata atcagcaact tacgaactta gagcagcaac tttcagacta tctacaggca      1680
     aatcgcccta gcattcaatt tttagtggat ggggtccatc aacatactga aacggctcag      1740
     tctgcctatt cccatttaca agccatcatg gattttgccc aagaggttaa cacccttact      1800
     cggcagattc agtctcaaaa tcaccagatt gtgactcaag tcgaaatagc tcaaaatcat      1860
     cccccccacc ttccacccgc cgctcaatcc gccatcactc aacttcaaga actggagaaa      1920
     cccttacagc agctttctca aattcgcata ttagtcaatc aactgtcctc ccagatgcag      1980
     ctacaggtga tgaatatcac agcaaaagca cctcaggact cagaggccta tcctgaatta      2040
     tctggttcag cccaaaagat cagcattgtc gctcaaaaga tagaagacaa tttggcccaa      2100
     atgaagccaa tactagagtc tttgcaacga gatctgcaac aaaatacggc tattctaaag      2160
     cccctagccc aacaaactag taccgtttct acagaacgat ttagatctga gcagctatcc      2220
     tctaatctaa atactgagtt ggctcagctc aatgatcaga tgaagaaact gactcagctc      2280
     gtgagtagcc atctgcaaac atcttccacc gcaagtcatc agatctttga attgaaccag      2340
     tttctgcagc gtcttgcacc acaagcccaa tcgatgcagg cctctatcca aaagatggaa      2400
     acagcagtaa ctcctgaaca atctccaggt tga                                   2433
//

If you have problems or comments...

PBIL Back to PBIL home page