(data stored in ACNUC27125 zone)

EMBL: CP000828.PE453

CP000828.PE453       Location/Qualifiers
FT   CDS_pept        complement(470099..470569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0491"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25544"
FT                   /db_xref="GOA:B0CC02"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC02"
FT                   /protein_id="ABW25544.1"
FT                   /translation="MSLVRPISTESLRLLHRIYHSSRHHQVRQRAHCLILFAQGWPPYT
FT                   LASLFSVSPKTVYNWLKAWNNRGFAGLYNHPGRGRKPMFNPDQQQQIYEWTQASPIQLN
FT                   QVLAQIEQQWSVRVSKATVKRVLKQMDMSWHRFRQGTSGQPLYAHYLEKNSS"
     atgtcattag tccgtcctat ctccaccgaa agcttacgct tattgcatcg gatttatcac        60
     agtagtcgcc atcatcaggt cagacaacgc gcccattgcc tcattttgtt cgcccagggt       120
     tggcccccct acaccttagc ctcccttttt agtgtgagtc ctaaaacggt ttacaactgg       180
     cttaaggctt ggaacaaccg aggatttgca ggactctata atcacccagg tcgaggtcga       240
     aaaccgatgt ttaatcccga ccaacaacag cagatttatg agtggactca ggcatctccc       300
     atccaactca atcaggtgtt agctcagatt gaacaacagt ggtcagtacg cgtgtcaaag       360
     gccacagtta aacgcgtctt gaagcagatg gacatgagct ggcatcgctt tcgccaaggg       420
     acatcaggcc agcctttata tgcccactac ctcgaaaaaa acagcagtta g                471
//

If you have problems or comments...

PBIL Back to PBIL home page