(data stored in ACNUC8465 zone)

EMBL: CP000828.PE455

CP000828.PE455       Location/Qualifiers
FT   CDS_pept        471054..471482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25546"
FT                   /db_xref="GOA:B0CC04"
FT                   /db_xref="InterPro:IPR005063"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC04"
FT                   /protein_id="ABW25546.1"
FT                   /translation="MSLAKDSGLVLGGRIGKHTDELAQELMENTEGKTACHHWQTDGWE
FT                   GYSRQLPNETIHHVSKALTQRLERTNGILRQQAGRWHRRQNKFGKVWQQRAVTLRLVLT
FT                   YFNWIWCHSRFKNTAAQRAGLAEHPWQWQDLVNYPTLY"
     ttgagtctcg ccaaagacag tggcttggtg ctcggtggac ggattggtaa acataccgac        60
     gagctcgctc aagaattgat ggagaatact gaaggcaaaa ccgcctgtca ccattggcaa       120
     actgatggct gggaagggta ttcacgacaa ttacccaatg agacgatcca tcacgtgagt       180
     aaagccctga cgcagcgctt agagcggacc aatggcatat tacgtcaaca ggccgggcgc       240
     tggcatcgac ggcagaacaa atttggcaaa gtctggcaac agagggcagt gacgttaaga       300
     ctggtgctga cctatttcaa ctggatctgg tgccactctc gattcaaaaa tacggctgcc       360
     caacgtgctg gactagcgga gcatccctgg caatggcaag acttagtcaa ctatcccaca       420
     ctttattga                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page