(data stored in ACNUC27125 zone)

EMBL: CP000828.PE456

CP000828.PE456       Location/Qualifiers
FT   CDS_pept        complement(471460..471831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0493"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25547"
FT                   /db_xref="GOA:B0CC05"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC05"
FT                   /protein_id="ABW25547.1"
FT                   /translation="MIYHTSSSQPSNVSQSLLGRFLKFLRHPRYTVNVATEHHGIVDVL
FT                   RLYALALVMVLPLGVLSSRLAENLESSNKVLEFAQTVSFWQIILFAVILAPLWEETVFR
FT                   LPLRYTPINRLCVNKVWDS"
     atgatttatc acacatcgtc ctctcagccg tcaaatgtat ctcaaagcct gttgggtcgt        60
     tttctcaagt ttttaagaca tcctcgctat acggtgaatg tggccacgga gcatcacggc       120
     atagttgatg ttctcaggct ctacgcattg gctttggtaa tggttttacc cctcggtgtg       180
     ttgagttcca gattggcaga gaatcttgaa tcgagtaaca aagtcttaga gttcgctcaa       240
     accgtatctt tctggcaaat tattttgttt gcggtgatac ttgctccgct ttgggaagaa       300
     acggtcttcc gattgccttt gcgctatacc ccaattaatc gattgtgcgt caataaagtg       360
     tgggatagtt ga                                                           372
//

If you have problems or comments...

PBIL Back to PBIL home page