(data stored in ACNUC27125 zone)

EMBL: CP000828.PE460

CP000828.PE460       Location/Qualifiers
FT   CDS_pept        complement(474372..475103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0498"
FT                   /product="transposase-associated ATP-binding protein,
FT                   putative"
FT                   /note="Upstream region overlaps with a putative
FT                   transposase."
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25551"
FT                   /db_xref="GOA:B0C653"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:B0C653"
FT                   /protein_id="ABW25551.1"
FT                   /translation="MLTHWESIESQAMQENWSYAEFLLALCETKAQRREQARLKRALTE
FT                   ARLPNAKSFTNFDFSHCPQLNPAPLMQLAADPGWLERAENCLILGPSGVGKTHLATGVS
FT                   KKMLEFGKRVKFFAANALVQHLQQAKLQLQLHPMLKKLDRYDLLVLDDLGYCKKSEAET
FT                   SVLFELIAHRYERKSLLITANQPFSQWDDIFTDSMMAVAAIDRLIHHGLIIKIQADSYR
FT                   RKSATQRTAQTQSPPQKSQSK"
     atgttgaccc attgggaatc tatcgaatcc caagctatgc aggaaaactg gtcttatgcg        60
     gaattcttac tagccttgtg cgaaacgaag gcccaaagaa gagaacaagc tcggctaaaa       120
     cgtgctctca ccgaagccag gctcccaaac gcaaaaagtt ttaccaactt tgactttagc       180
     cattgtcccc agctcaatcc tgctcccttg atgcaattag ccgcagatcc gggttggttg       240
     gagcgcgccg agaactgcct tattttggga ccctcgggcg ttggaaaaac acatctggcc       300
     actggagtgt ccaaaaagat gctggaattc ggtaagcggg tgaagttctt tgcagccaac       360
     gcattggttc aacacttgca acaggcgaag ctccaactgc agctgcatcc aatgctcaaa       420
     aaactggacc gctatgatct gttggtcttg gatgacttgg gctattgcaa aaagtcggaa       480
     gcggaaacgt ccgttctgtt tgaattaatt gcgcatcgct atgaacgaaa aagtttgttg       540
     attacagcga atcaaccctt cagccaatgg gatgacattt tcactgattc gatgatggcg       600
     gtggctgcca ttgatcgctt aattcatcat ggcttgatta tcaaaattca agccgatagt       660
     tatcggcgca aatcagcgac tcagagaacg gctcaaactc agtctccacc tcaaaaatcc       720
     cagtccaaat aa                                                           732
//

If you have problems or comments...

PBIL Back to PBIL home page