(data stored in ACNUC8465 zone)

EMBL: CP000828.PE468

CP000828.PE468       Location/Qualifiers
FT   CDS_pept        481826..482071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0508"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25559"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC17"
FT                   /protein_id="ABW25559.1"
FT                   /translation="MIFDHLRQFRQTLYSCFGASKDALFELMDAVLMSPSLRSFVCLSQ
FT                   HPIFRRQWSSTYSALHDGRIHRAKLHRYLGFAEKVN"
     atgattttcg accatctgcg tcaattccgc caaactctgt atagctgctt tggcgccagt        60
     aaagacgcgt tatttgagct aatggatgcg gtattgatga gtccgagcct gcgttcattt       120
     gtgtgtttgt ctcaacatcc tatcttccgt cgtcaatggt cgagtaccta ttcagccctg       180
     catgatggtc gtatccatcg tgccaaactt caccgatatt tagggtttgc tgagaaagta       240
     aattga                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page