(data stored in ACNUC5340 zone)

EMBL: CP000828.PE471

CP000828.PE471       Location/Qualifiers
FT   CDS_pept        complement(485023..485331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0510"
FT                   /product="peptidase S26 family protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25562"
FT                   /db_xref="GOA:B0CC20"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR014124"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC20"
FT                   /protein_id="ABW25562.1"
FT                   /translation="MLWCCRRRRRWEVQGRSMMPTLSPGDQVLIDPRAYRLTTPQVGDI
FT                   VLARHPFQSQLYLIKRIQSVDDNSYFLIGDNAPESTDSRVFHAVPLDCIVGKVTSFF"
     ttgctatggt gctgtcgacg acgacggcgt tgggaggtgc aggggcgatc aatgatgcca        60
     accctaagcc ctggcgacca agttttaatt gatccgcgag cctatcgact aacaactcct       120
     caagttggtg atatcgtgtt ggctcggcac ccttttcaaa gtcagcttta tttaatcaag       180
     cgtattcagt cagtggacga caattcctat tttctaatag gagataatgc gcctgaaagt       240
     actgatagtc gggtatttca tgctgttcct ttagattgta ttgtcggtaa agtaaccagc       300
     tttttttag                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page