(data stored in ACNUC8465 zone)

EMBL: CP000828.PE473

CP000828.PE473       Location/Qualifiers
FT   CDS_pept        complement(485925..486413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0512"
FT                   /product="TPR domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25564"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC22"
FT                   /protein_id="ABW25564.1"
FT                   /translation="MAYDPQIYSSYELNWQLHTQAGNQCLLAGSYLEALHAYRKAIALA
FT                   ELMLMTAKKERRHPEAIHAYVMACHNLADNLVKLEDFQVAETTMQQALDRVVDLMHATH
FT                   YFQCLRIEAAKALKMVSLKVYEFYLRLGQQDKARRVFEHNTELAQMFFSQIQPRLLSV"
     atggcttacg atcctcagat ttactcttcc tacgaattga actggcagtt gcacactcaa        60
     gcaggcaatc agtgcctgct tgcaggttca tatctggaag cgcttcatgc ctatcgcaaa       120
     gccattgcct tagctgagtt aatgttgatg actgccaaaa aagagcgtcg tcacccggaa       180
     gctatccatg cttatgtgat ggcttgccac aatttggccg ataatttagt aaaacttgag       240
     gatttccagg ttgcagaaac cacgatgcaa caagcgttgg atcgagtggt tgatttgatg       300
     catgccaccc actattttca atgcctccgc atcgaagctg caaaagcatt gaaaatggtt       360
     agcctcaagg tctatgagtt ttatctgcgt ctaggacagc aggataaagc tcgcagggtg       420
     ttcgaacata acactgagct tgctcagatg ttttttagtc agatacaacc ccggttgttg       480
     agtgtatag                                                               489
//

If you have problems or comments...

PBIL Back to PBIL home page