(data stored in ACNUC27125 zone)

EMBL: CP000828.PE478

CP000828.PE478       Location/Qualifiers
FT   CDS_pept        complement(491186..491326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0517"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25569"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC27"
FT                   /protein_id="ABW25569.1"
FT                   /translation="MINRQSRQKMNELPWLLIDPSLCERTLQQYDQLIQLLRKFSLIEP
FT                   E"
     atgatcaatc gtcaaagtcg ccaaaagatg aacgaattac cttggttact gatagacccc        60
     tcactctgcg agaggacatt acagcaatac gatcaactga ttcaattact gcgaaaattt       120
     tctttgatag aacctgaata g                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page