(data stored in ACNUC27125 zone)

EMBL: CP000828.PE481

CP000828.PE481       Location/Qualifiers
FT   CDS_pept        492902..493978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25572"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC30"
FT                   /protein_id="ABW25572.1"
FT                   /translation="MDWRDPLWSDLLTHLSHDIYHLPEYLYCEALRTQSIPEAILITEG
FT                   QKVCLIPYLRRSCNFIPTASSPTNIYDITSPNGYSGFLLNPAALDDSAFGFHAWQQFLD
FT                   LGKEQGICSAFLRLHPSLNTIHPQGINNILVKKVGHTVSINLGLSESDLWSHTHKSQRN
FT                   KINRGKRLGLVAKIKPFSEYINEFCNIYEATMQRVEAETSFFSFNRDYFYLLQKHLGHK
FT                   LFVCIVEYQDEIISAGLYSECSGIVQGLLGGTTPEGLKLSPTSLEFYQTSLWAKQRGNT
FT                   ILHLGGGVGCSEDGLYQYKANFSKQRHEFYTASIIIKPLQYKLLLESHSKAHNIDLDHL
FT                   NSIQFFPAYRYRPNPSEF"
     ttggattggc gcgatccctt atggtcagac ctgctgactc acctgtctca cgacatttac        60
     cacttacctg aatatctgta ttgtgaggcc ctgagaaccc aaagcattcc agaagcaatc       120
     ctaattacag aggggcaaaa agtctgccta attccctatc tacgacggtc ttgcaatttc       180
     attccaacag catcgtcccc tactaatatc tatgacatca catcacccaa tgggtattca       240
     ggatttttac tcaatccagc agccctagac gattcagcat ttggcttcca tgcttggcag       300
     caatttcttg acttaggaaa agaacaggga atttgctcag cgtttcttcg tcttcaccct       360
     agtcttaata ccattcatcc ccaagggata aataatatcc tcgtcaaaaa agtggggcat       420
     acggtctcca ttaacttagg gctttcagaa tcagacctct ggagtcatac ccataaaagc       480
     cagcgaaaca aaattaaccg agggaaacga ctggggttag tggcaaagat caagccattt       540
     tctgaataca tcaatgaatt ctgcaacatc tatgaagcta cgatgcagcg ggttgaagct       600
     gagaccagct ttttttcatt taatcgagat tacttttacc tactccaaaa gcatcttggt       660
     cataaactat tcgtttgtat tgttgaatac caagatgaaa ttatttctgc tggactctat       720
     tcggaatgtt cgggtattgt ccaaggacta ttaggaggga caacccctga agggctaaaa       780
     ctttctccca caagcctaga gttttatcaa acgagtctat gggcaaagca gcgggggaat       840
     acaatccttc atttaggcgg tggagtcggt tgttctgaag atggtcttta tcaatacaaa       900
     gcaaactttt cgaagcaaag gcatgagttt tataccgcat ctatcattat taagccgcta       960
     caatataaac tgctccttga atcccattca aaagcgcata acattgatct tgaccattta      1020
     aactctattc agtttttccc agcttaccga tatagaccca atcccagtga gttttag         1077
//

If you have problems or comments...

PBIL Back to PBIL home page