(data stored in ACNUC27125 zone)

EMBL: CP000828.PE482

CP000828.PE482       Location/Qualifiers
FT   CDS_pept        494032..495108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25573"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC31"
FT                   /protein_id="ABW25573.1"
FT                   /translation="MDVQILALDDPRWLQVLDGIRHDVYHLPTYVSIESKRLKAPAEAI
FT                   VVQDKNKILFLPYLLRSCKDVCSDHLKDKEILDIISPYGYSGIALSPEAIGDPIFIQSS
FT                   LQESIKAFKDKNICSAFFRLHPILSSQYIEHLDSPTATPDGVTVSVDLLQPESKIWAHT
FT                   RKGHQSTINKCKRLGLQARIVPYAESIEVFTSIYTETMNRVSATQSYYFNQDYFENLLN
FT                   LGDKLHCCIVENADQIVAASLFFECCGIVQAHLGGTRTAFMPQSPFSLLLHHMRLWAKE
FT                   QGNEFLHLGGGVGGSQEDRLFKFKSGFSKQQHDFYTLRLIVNPEVYAELLQHRAQAIDV
FT                   PVEQLQQSTFFPAYRTAS"
     atggatgtgc agatacttgc attagatgat cctcgctggc tccaagttct tgatggtatt        60
     cgacatgatg tttatcactt gcctacctac gtttccattg aatccaaacg tttaaaggct       120
     cctgcagaag cgattgtggt tcaagacaaa aacaagatac tttttttgcc ttacttactt       180
     cggtcctgta aagatgtttg ctctgaccat ctaaaagata aagagatact cgatattatt       240
     tctccctatg gttattcagg aatcgccttg agtccagaag caattggaga cccaatattt       300
     atccaatcat cactccaaga gagcattaaa gccttcaaag ataaaaacat ttgttcagcc       360
     ttctttcggc ttcacccgat tttaagctcc cagtatatcg agcatcttga ttcccctacg       420
     gcaaccccag acggtgtaac cgtttcagtt gatttattgc agccagagtc aaagatttgg       480
     gctcacacca gaaaagggca tcaaagtact attaacaagt gcaaacgatt gggactgcaa       540
     gccagaattg ttccttacgc tgagagtatt gaggtcttta cgtctattta caccgagacg       600
     atgaaccggg tttcagccac tcaatcctat tactttaatc aagactattt tgaaaacctg       660
     ctcaatttag gtgacaagct acactgctgt atcgtcgaaa atgctgacca aattgttgcc       720
     gctagcttat tttttgaatg ttgtggcatt gttcaagccc acctcggtgg aacccgtacg       780
     gcgtttatgc cccagtctcc ttttagcttg ctgcttcatc atatgcgcct ctgggcaaag       840
     gagcagggaa atgaatttct acacctaggt gggggggtgg gcggatcgca agaggatcgg       900
     ttatttaaat ttaagtcggg cttttctaag cagcagcatg atttttacac cctcaggttg       960
     atcgtcaatc ctgaagtcta tgctgaattg cttcaacatc gggcgcaagc tatagatgta      1020
     ccagttgagc aattacagca atccaccttt tttccggcat atcggacagc ctcctaa         1077
//

If you have problems or comments...

PBIL Back to PBIL home page