(data stored in ACNUC27125 zone)

EMBL: CP000828.PE489

CP000828.PE489       Location/Qualifiers
FT   CDS_pept        complement(504339..504821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0528"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25580"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC38"
FT                   /protein_id="ABW25580.1"
FT                   /translation="MLKEGQLLSLSESYPAGLILQKPYYAEYIGPGSAVGGMFDLQCVT
FT                   IHPLGKAELSTPETLDERQNAFQRRMEDIEQMQLICEKDLPIERAVAVLEMLTQHFYQD
FT                   EIQMIPNEVLAKLVGVLPSTMATAWKQLSTGGRKPSAPSQSSAPEPSFASHEVAFA"
     atgctgaaag aaggacaact attatcctta tccgagagct accctgcagg actcattctg        60
     caaaaacctt attatgctga gtatattggt ccgggttcag ccgtaggtgg gatgtttgat       120
     ctccagtgcg tcacgattca ccctttgggc aaagctgaac tcagtactcc tgagacgttg       180
     gatgagcgcc aaaacgcgtt tcaaaggaga atggaagata tcgaacagat gcagctaatt       240
     tgtgaaaaag atctacccat cgaacgagca gttgcagtac ttgaaatgct aactcagcat       300
     ttttaccaag atgagatcca aatgattccc aatgaagttt tggctaagct ggtgggggtt       360
     ttaccttcaa caatggcgac agcttggaaa caattatcga ctggtggccg caagccaagt       420
     gccccttcac agtcctctgc tcctgagccc agttttgcgt cccatgaggt ggcgtttgcc       480
     tag                                                                     483
//

If you have problems or comments...

PBIL Back to PBIL home page