(data stored in ACNUC5340 zone)

EMBL: CP000828.PE491

CP000828.PE491       Location/Qualifiers
FT   CDS_pept        complement(505909..511095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25582"
FT                   /db_xref="GOA:B0CC40"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC40"
FT                   /protein_id="ABW25582.1"
FT                   /translation="MPQPSPPGQASRPSPPHRHFTRLHVLLIVVGLLLAAIAGVSWWVL
FT                   RFIDEDLTPLVAEELSKTLNRPVKMGEVQNYSLTHIRFGPSEIPACSPQQGCAKEDADS
FT                   AKMEAVDIRFNLLPVLWSRKLPLEATLIKPQLYLDQTQDGEWIATRLRSGPSKAWIKVK
FT                   LNQLQVQQGTAQIEPANIEARQFSQLNGTLNFSTPETLYFNTQSQVDSGGQLSVKGAWQ
FT                   SKQKKLEVNAQTKDLVAAPLMGLLPKLPFEINKGQLQGQFQVKLLPQHPVTIHSDATLS
FT                   QGDIWIPRQAIRVQANNIRTDVRIEVPPQRPVELKGEAYIDGARADVPEDLILDNRRQR
FT                   PRRLSQLQGTVDFLGLKQRFRFDLQGRMGQTGRLKARGTASFLEQQTNMRLQLQNLPAP
FT                   LFDQAFQLPITADSGQVSASIRVKLRPKQRPDVQGTALLKRVEMGIVNVPQPFSRVRGF
FT                   LRFKGIAVRLEGLKGDYGQIPMQATGWIDPDRGYSLVGQTEWVAAQPTLETLQVTGLPF
FT                   PVTGQFKGDNLRFDGAIDQPIFSGSVQLAKQPKVDRVPFKQLTAQFQLADALLKMEDIK
FT                   AEPTAGGQFRGTARFNVEPGGQLLTQLEASNIPGNGIAQSYQADPGFPLGPLQGQIKIF
FT                   GPPDDIRTNVDFQALKGQFPTRGNVFVRDSIAQLRRIVTQIPGGELRTQGQIKDNRVNV
FT                   TTTTSGVALKAYTPDARGLMTGQLRITGPFDGFSVNTARVKGQARFSDGIAIVYDPIAA
FT                   QLRWDGQQILVDQATAPGFWSQGQVGLDFDTPQGPQLTTLNLAVRSRGYDLGLFPPFGP
FT                   TQVKMAGRANLVGQLTGTVADPYLESTVQINNLLVGGIPFENQLKGKMLYGQQAKLDLR
FT                   VSGQRDRINLALNSNQLPTAFDIRRDQAWAKGKTEQGKLNLAFQEVPLAALNWKPVDNL
FT                   GPISGLSSGEFSLNPTTYAGAGTLAVTRPALGKLVGDQFLGRFQLTSDTIQLQQGELRD
FT                   RNNLYQLQANVIPGINPKFSGTLNIRQTEIADLVAAATSLNLNPSALPDQPRGKAKDVE
FT                   TLPVGSAQESLMMQLRRLSELDALATQQQADAPPDPLFPDLNELSGKLAGRLQFSGSLQ
FT                   SGLDTRFALQSKALKWGDYAIDRITAQGQYTDGSLKLRPLLVATGKQEAKFQGTIGLQQ
FT                   QSGQLTLKNLPLQGLNQFLDLPFEVAGTVNGTATLAGTLADPRLQGELNWDEARVNTLA
FT                   LNQARTTFAYNRGRLTFEGGSEALPFRFTGNIPYQLPLTAVGPDSDALDVSLKVKDDGL
FT                   SLINLFTDQLNWVEGQGEIDLNVTGTLTQPSMQGSIQLNQATLTSDLLFEPLTNVTGTI
FT                   QFDRNQLRINRLIGLYSQGELEASGSLPLFVSEPPPSSASLQLALKALKLNVKGLYKGQ
FT                   IDGDLKISGSLLAPQLGGVMALTNGQVILADVNVASSSAPGQFGQTTPLEFNNLQVQLN
FT                   NNVRVTQPPLLSFVAAGNVTANGSVNAPRPAGRIRFRQGSVNLFTSRFRIDSRRDNFAE
FT                   FDPSLGLDPFLSIGMVTTATDIAGGRATELNEFEDLPAGRIGAIESVRVRATVEGRASE
FT                   LVNNFNQVVQLTSTPSRSEGEILALLGGSVTNNLEDGNTELALVNLASSAFLTGFEGLF
FT                   SDALGTRASFRLFPVLIPNDDQDQSVLAFGAELGYDVTDRFSVSALQILTGLDEATLFN
FT                   ASYDINEQLRVRSAISTDGEAVGILEYRIRF"
     atgccccaac cttcccctcc cgggcaagct tctcgtccat ctcctcccca tcgacacttc        60
     actcgtcttc acgttctgct cattgtagtt gggttgttac tggctgcgat cgcaggggtg       120
     agctggtggg tgttgagatt tattgatgaa gacttaaccc cccttgtggc agaggagctg       180
     agcaaaactt taaatcggcc cgtcaaaatg ggggaggtac aaaattactc cctcacccat       240
     attcggtttg gaccgtcgga gattccggct tgttcgcccc agcaaggatg tgcgaaagaa       300
     gacgctgact ccgccaaaat ggaagctgtt gatatccggt tcaacctgtt gccagttctc       360
     tggagccgca aactgcctct agaggcaaca ctgatcaaac cccagctgta cctcgaccag       420
     acccaggatg gggaatggat tgcgacgcga cttcgctctg gaccatcaaa ggcttggatt       480
     aaagtcaaac taaatcagct tcaggtgcag cagggaacgg ctcagattga accggccaac       540
     atcgaggctc ggcaatttag ccagctcaac ggcaccctta atttctcaac cccagaaacc       600
     ctatacttca atacccaaag ccaggtggat tcggggggcc aactttctgt taaaggggca       660
     tggcaatcca aacagaaaaa gttagaggtg aatgcccaaa caaaggacct cgtggctgct       720
     cctttgatgg gcctactgcc caagcttccg ttcgaaatca acaaaggaca attacagggg       780
     caatttcagg tcaaactgct tccccaacac cccgtaacca ttcattctga tgccacctta       840
     tcccaagggg atatttggat tcccaggcaa gccattcggg tccaagccaa caacattcgc       900
     accgatgttc gcatcgaggt gccccctcag cgtccggtgg agctgaaggg agaggcctat       960
     attgatggag caagggcaga tgttcctgaa gatctaatcc tcgataaccg acgtcagcgg      1020
     cctcgccgtt tgtcccaact ccaggggacc gttgatttcc tggggctcaa acagcggttt      1080
     cgctttgatc tccagggacg gatgggtcaa acagggcgac tgaaagctag aggcactgcc      1140
     tccttcctag aacaacagac caatatgcgc ttgcagcttc agaatctgcc agcgccccta      1200
     tttgaccaag cctttcaact ccccatcacc gcagattcgg ggcaagtcag tgccagcatt      1260
     cgggtaaaac tccgtcccaa acagcgtccg gatgtccaag gtacggccct actcaaacgt      1320
     gttgagatgg gaattgtcaa tgttcctcaa cccttcagtc gtgtacgcgg atttctgcga      1380
     tttaaaggaa tcgccgtgcg cctagaaggg ctcaaggggg actatgggca gatccccatg      1440
     caggctacgg gctggatcga cccagatcgc ggctatagct tggtggggca gacagagtgg      1500
     gtagccgctc aacccaccct ggaaaccctc caagtcacag gtttaccgtt tcccgtgacg      1560
     ggacagttca aaggggataa tctccgattt gatggtgcca ttgaccaacc cattttttcg      1620
     ggttcagttc aattggcaaa gcaaccaaag gtggatcggg taccgtttaa acaactgaca      1680
     gctcagttcc aattggctga tgccttgcta aaaatggagg acatcaaagc tgagcccacg      1740
     gcagggggac agtttcgagg gacagcacgc tttaacgttg agccaggggg acagttatta      1800
     acccaacttg aagccagcaa tatccccggg aatgggattg cccagtccta ccaagccgat      1860
     ccgggttttc ccttgggtcc cctccaagga cagattaaga tatttggtcc cccagacgat      1920
     atccgtacca atgtcgattt tcaagctctg aagggacaat tcccgactag gggaaatgtt      1980
     tttgttcgcg atagcattgc tcaactcaga cggattgtca ctcagattcc ggggggagaa      2040
     ctgcggaccc aaggtcagat taaagataat cgggtcaacg tcacaacgac gacgtcagga      2100
     gtagccctaa aggcttatac ccctgatgct cggggactca tgacgggaca acttaggatt      2160
     actggacctt ttgatggctt tagcgtcaat acagccagag taaaagggca ggcccgcttt      2220
     tctgatggga ttgccattgt ctacgatccc atcgctgccc aactgcgatg ggatggacag      2280
     caaattttgg tggatcaagc cacagcccca gggttttggt ctcaaggcca agtgggcttg      2340
     gattttgaca cgccccaagg tcctcagctg acgaccctta atctggcagt ccgttctcgg      2400
     ggttacgatt tgggattatt tcctcccttt ggccctacac aggtcaaaat ggcggggcga      2460
     gccaacctcg tggggcaact cacggggact gtggcggatc cctatttaga gtccacagta      2520
     caaatcaata acttattggt cggagggatt ccctttgaaa atcaactcaa gggcaagatg      2580
     ctgtatggac agcaggccaa gctagattta cgcgtatcgg gacaacgaga tcgcattaac      2640
     ctcgcattaa attccaatca attacccacc gcctttgata tccgtcgcga tcaagcctgg      2700
     gcgaaaggca aaacggagca gggtaagcta aaccttgcgt ttcaagaggt tcccctcgca      2760
     gccttaaact ggaagcccgt tgataacctt gggccgatct ctggcctctc atcaggtgaa      2820
     ttctcgctta atcccaccac ctatgcgggg gctggcaccc ttgcggtgac ccgtcctgcc      2880
     ctgggcaaat tagtgggcga tcaattttta ggtcggtttc aactgacgag cgataccatt      2940
     cagttgcaac aaggtgaatt acgcgatcgc aacaacctat accagctcca agccaacgtt      3000
     atccctggca ttaatcccaa attttcaggg actctcaaca ttcgccaaac cgaaattgcc      3060
     gatttggtcg ctgcggcaac atccctcaat ctcaacccat cagcgcttcc agatcagcct      3120
     cgagggaaag ccaaagatgt tgaaaccctt cccgttggct ccgcccaaga gtctttaatg      3180
     atgcagcttc gccgcctgtc tgagttagat gccttggcga cgcaacaaca agctgacgct      3240
     cctccagacc ctctatttcc cgatttaaat gaattatccg gtaagctggc aggccgacta      3300
     cagttttcag ggtctctaca atcaggtcta gatactcgtt ttgcgctgca gagtaaagcc      3360
     ttgaagtggg gggactatgc cattgatcgt attacggcac aagggcaata tacagatggc      3420
     agcttaaaac tccggccttt gttggtggca acgggaaaac aggaagccaa gttccaggga      3480
     acgattggtc ttcagcagca gtccggccag ctaaccctaa agaatttacc tttgcaagga      3540
     ctgaatcaat ttctcgattt gccctttgag gttgcgggta cggtgaatgg aacggcaacc      3600
     cttgctggca ctttagccga cccacgtctc cagggtgaac tgaattggga tgaggctagg      3660
     gtgaataccc tggcactcaa tcaagctcga acaacctttg cttataaccg ggggcgattg      3720
     acctttgagg gcggctcaga ggctcttccc ttcagattta caggaaatat cccctatcaa      3780
     ttacccttga ctgcggtggg accggatagt gatgccctgg acgtatctct gaaagtgaag      3840
     gatgatggcc tatctctgat taacttattt acagatcagc ttaattgggt agagggtcag      3900
     ggagaaatcg atctcaatgt cactggtacc ctaacccaac cttccatgca ggggagtatc      3960
     cagttaaacc aggccacact gacatctgat ctattatttg aacccctcac caacgttacc      4020
     ggaaccattc aattcgatcg caatcaatta cggattaacc gcctgattgg cctctatagc      4080
     cagggcgaac tggaggcttc gggcagcctc cccttatttg tttccgagcc tcctccctct      4140
     tctgcatcgc tgcaactagc gcttaaagcc ctcaaactca atgtcaaagg actgtataaa      4200
     ggtcaaattg atggcgatct gaagatttct ggctccctgc tagcccctca attggggggc      4260
     gtaatggcct taaccaatgg ccaagttatt ttggctgatg tcaacgtggc ctcatctagt      4320
     gctccaggcc aatttggaca aaccactcct ctggaattta acaatctgca agttcagctc      4380
     aataataatg ttcgggttac tcagcccccc ttgcttagct ttgttgcggc gggtaacgtc      4440
     actgcgaatg gttcggtgaa tgcccctcgt cctgccggta ggattcgatt tcgtcagggg      4500
     tctgtcaatc tatttactag ccgttttcgg attgattcgc gtcgagataa ttttgccgaa      4560
     ttcgatccga gcttggggtt ggatcctttt cttagcattg gcatggtgac gaccgccaca      4620
     gacattgctg gagggcgggc cacggaactg aatgagtttg aggacctccc tgcaggccga      4680
     atcggggcca ttgaatcggt gcgcgtccgg gcaacagtgg aaggacgggc tagtgagctg      4740
     gtcaataact ttaatcaagt ggtgcagttg acaagcacgc ccagccgttc ggagggagaa      4800
     atcctagctt tgttgggggg gagtgttacc aataatttag aagatgggaa tactgaactt      4860
     gccttagtta acttggctag ttcggcattt ctaaccggat ttgaaggatt attctccgat      4920
     gccttgggaa cacgggccag cttccgcttg ttccccgtat taattcccaa tgatgaccaa      4980
     gatcagtctg tgttggcatt tggagccgaa ttgggttatg acgtgacgga tcgattctcc      5040
     gtgtcggcct tgcaaatctt aacgggacta gatgaagcca ctttatttaa tgcgagttac      5100
     gacattaatg aacaactacg ggtgcgaagt gctatcagta ctgatggaga agctgttggc      5160
     attctcgaat atcgcattcg tttttga                                          5187
//

If you have problems or comments...

PBIL Back to PBIL home page