(data stored in ACNUC5340 zone)

EMBL: CP000828.PE502

CP000828.PE502       Location/Qualifiers
FT   CDS_pept        complement(523758..524648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0543"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25593"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC51"
FT                   /protein_id="ABW25593.1"
FT                   /translation="MFILLLQIAMLRLYPLIKLRPSPSETGFTLAEKMVIGAIIGIAAT
FT                   ASAPSIMATMNRAKVKQTMAEVRTALNETQREAIKGNKICTLTLNFVEGKITGPCLKSG
FT                   DRTLETDVAIATNLTDPNSNTARTNEGQPVLIGSDVQPSLGLSDGETISQIAMAPVPEA
FT                   KASKAGVIVQVIAKCKGNTEKGLGLGTCKNKDKDESGNGGHDSPSSPGPSASIPIKYGV
FT                   LGNPEFAIVSAQQTPTDPSGKIIFYSPDDSKATKRCIAISNTLGLTRIGTYQGDMSPAA
FT                   ITDSGRCTAENWEEQ"
     atgttcattc ttctgctgca aattgccatg ctccgcttgt atccattgat taaactcaga        60
     ccttcaccct cagagacggg gtttactctg gctgaaaaaa tggtcattgg tgccattatc       120
     ggcatcgctg ccactgcctc agccccgagt attatggcga ccatgaaccg agccaaagtt       180
     aagcagacaa tggcggaagt ccgcacagca ttgaatgaaa ctcaacgaga agccattaaa       240
     ggcaataaaa tttgcaccct aaccctcaat tttgtggaag ggaaaataac tggaccttgt       300
     ctcaaatcgg gtgatcgcac cttggaaacg gatgttgcga tcgcaactaa tttgacagat       360
     ccaaactcaa acacagcccg taccaatgaa gggcagcccg ttctaattgg ttcagatgtg       420
     caaccctctc taggactgag cgatggtgaa actatctccc aaatcgctat ggctcctgtt       480
     cctgaagcaa aagcatctaa agcgggggtg atcgttcagg ttatcgctaa atgtaaaggt       540
     aataccgaaa aaggattagg tttagggact tgcaaaaaca aagataaaga tgagtcagga       600
     aatggtggac acgattcgcc ctctagtcct gggccatcag ccagcatccc gatcaaatat       660
     ggtgttttag gcaaccctga atttgcgatt gttagtgctc aacaaacacc aacagatcct       720
     agtggcaaga ttatctttta cagtcctgat gattccaaag ccactaaacg ctgtattgcg       780
     atttccaata ctttagggtt aacccgtatt ggtacctatc aaggcgatat gagtccagct       840
     gccattacgg actctggccg ttgcactgcc gagaactggg aggagcaatg a                891
//

If you have problems or comments...

PBIL Back to PBIL home page