(data stored in ACNUC27125 zone)

EMBL: CP000828.PE505

CP000828.PE505       Location/Qualifiers
FT   CDS_pept        528831..529232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25596"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC54"
FT                   /protein_id="ABW25596.1"
FT                   /translation="MSRSKSILSLGSCAFVALSAILPFGAHAQADPSQLGIPEETTFAI
FT                   ITRMSDTVAARISASSCKDTRDLLKEMRKSKGSKTSELSLEGQLLASARTQPKLQQVVA
FT                   NRVGTALALKLMECNMMNPDTLGALFDKK"
     atgtcgagaa gcaaatcaat cctatcttta ggaagttgcg cctttgttgc gctcagcgca        60
     atcttaccct ttggggcgca tgcccaagca gatccttcac agttaggaat tcctgaagag       120
     acaacatttg ctatcatcac gcggatgagt gatactgttg ccgcccgtat ctcagcctcc       180
     tcctgcaaag atactcgcga tctgttgaaa gagatgcgta agagcaaggg tagcaaaacc       240
     tcagagctat ctctagaagg tcaattactg gcctctgccc gtacccaacc gaaattacag       300
     caagttgtag ccaatcgtgt tggcacagcc ttggccctca agctgatgga gtgcaatatg       360
     atgaatcctg atactctagg ggccttgttt gataagaagt ag                          402
//

If you have problems or comments...

PBIL Back to PBIL home page