(data stored in ACNUC5340 zone)

EMBL: CP000828.PE511

CP000828.PE511       Location/Qualifiers
FT   CDS_pept        537907..540255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0552"
FT                   /product="abortive infection protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25602"
FT                   /db_xref="GOA:B0CC60"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B0CC60"
FT                   /protein_id="ABW25602.1"
FT                   /translation="MGQPLRAEVKSSSPPQLSAAQISNAEEGYRPVGEWVGRLILPPAD
FT                   GTDWVWFEVHHSPNPKFVGQTVRLQWQDHPDVQARIKRVQQDINLSAEAHQSLKRGNIH
FT                   PQRLDGRRQVGPLQSLAGARPTDDLIVSLKKVQAVNAPSPYLEIAVDPLQVPGFDYGLV
FT                   KILGPVSTSESVPKDCPGSPPCPSELTRVRHYNPLTQRFNGPEERVHIRQDQPNSAGVF
FT                   QSTPRKLADSPAGRSGWYIYGSKNMEGVFEVNAIAPRSLFQLQPDHHFSTMGAGLHYFK
FT                   RKVWQQTVQHKGKLQRALVDSQHRRQKKAVDQWQEGDQALVVHLFGGIGGNKAEPQAVI
FT                   GTVTGHFGYGIATVIKDPFTGERQFEIEYQQVYAHNPEGIVAGPTHWSEYMGHLNRGWL
FT                   GSRPVLDVLVKSAALTQPYKFGEISLDPLAELKTQLQLMAARYRIGDGTGSALVTPAKS
FT                   CVQDSSQAVYQTIKRIQYQVQMSPAIQTWLSEHPHAPQTLRFQELTTLGNALEKELVPL
FT                   GIVRSDWQQNAQVAAGISTPGTFRQSDDFLAQVLSWRTLIPRVAQDQIIRIFLKQGTPL
FT                   WFLNTNQVGGWDADIRPLAPTELFGKWPVVSFSFSRLVEATTTVPTPMGWLVSGGILGG
FT                   YGLFAVVWGRKVGFLTPPKWAAYSPSVQIRLWIGTLIMPALVEELLFRCLLIPHPQEGV
FT                   WWVTLLLWSGFSLILFVLYHPLNARTLYRAGDPTFFDLRFLTLATVLGIVCTGTYLFTG
FT                   SIWPGTILHWLAVAIWLLYLGGQERLSKV"
     atggggcagc cccttcgggc agaggtcaaa tcttcttcac cccctcaact ctctgccgca        60
     cagatctcta acgctgaaga aggctatcgt ccagtggggg agtgggtcgg aagactgata       120
     ctaccacccg cagatggcac ggactgggtt tggtttgaag tgcaccatag tcccaatccc       180
     aagtttgtgg ggcaaactgt gcggttgcag tggcaggatc atcctgatgt ccaagcccgc       240
     atcaaacggg tacagcagga tatcaacctc tctgcagaag cacatcaaag cttgaagcgg       300
     ggtaatattc acccgcaacg attagatgga cggcggcagg tgggaccatt gcagtcctta       360
     gcaggagcaa ggcccacaga tgacctgatc gtaagtttaa agaaggtgca agccgttaat       420
     gcccctagtc cttacctaga aattgcagta gatccgctac aggtccctgg attcgactat       480
     ggactcgtca aaatcctcgg tccagtctcc acgtcagaat ccgttcccaa agactgtcct       540
     ggatcacctc cttgtccgag cgagttgact cgggtgcgtc actacaatcc cctgactcaa       600
     cgatttaatg gtcctgaaga aagggtacac attcgtcagg atcagcccaa ttcagctgga       660
     gtctttcagt ccactcctag gaaattagcc gactctccgg ccggacgttc aggctggtat       720
     atctatggtt cgaagaatat ggaaggggtg tttgaggtga atgcgatcgc acctcggtct       780
     ctgttccaac tccagcctga tcatcacttc tctaccatgg gggcaggact gcactacttc       840
     aaacgcaaag tttggcagca aactgttcaa cataagggca aactccaacg agccctggtt       900
     gatagccaac atcgtagaca gaaaaaagcc gtggatcagt ggcaggaagg tgatcaagcc       960
     ttagttgtcc atctgtttgg cggtattggt ggtaacaaag ctgagcccca ggcagttatc      1020
     ggaacggtca cggggcattt tggctacggt atcgctacgg tcattaaaga tccctttacg      1080
     ggggaacgtc agtttgagat cgagtaccaa caggtttacg ctcacaaccc agagggaatt      1140
     gtggccggac cgacccattg gtccgaatat atgggccatc ttaaccgggg atggttggga      1200
     agtcggcccg tattggatgt gttggtaaag tctgcggccc tgacgcagcc ctataaattt      1260
     ggcgagatca gtctagatcc cttggctgag cttaaaaccc agctacaact aatggcagca      1320
     cgctatcgaa ttggtgatgg tacaggttcc gctttagtta ccccggcaaa atcctgtgtt      1380
     caagattcca gtcaagcggt ttaccaaacc attaagcgta ttcaatatca ggtgcaaatg      1440
     tccccagcca ttcaaacttg gttgtcagaa catcctcacg cccctcaaac ccttcggttt      1500
     caagaattaa cgactttagg gaatgccctg gagaaagaac tagtccctct gggcattgtc      1560
     cgcagtgatt ggcagcaaaa tgcccaggtt gcggcaggta tctcaacacc tgggacattt      1620
     cgccaatcag acgatttctt ggctcaggtt ctgagctggc gaaccctgat tcctcgggtt      1680
     gcccaagatc aaatcattcg tatttttctg aagcaaggta ccccgctttg gtttctcaac      1740
     acgaatcagg ttggaggttg ggatgcggat atcagacccc tcgcccccac agagttattt      1800
     gggaaatggc cagtcgtttc cttttccttt tctcggttgg tggaagcaac cacaacggtt      1860
     ccaactccga tgggatggct cgtttcagga gggattttag gaggctatgg tctctttgct      1920
     gtcgtttggg gccgaaaagt ggggtttctg accccaccca aatgggctgc ttattcccca      1980
     tctgtgcaaa taagactctg gatcggcact ttgatcatgc cagccctagt cgaagaatta      2040
     ttatttcgct gcctcctcat tccccacccc caagaaggtg tgtggtgggt gacgctgctg      2100
     ctttggtcag gatttagctt aatcctcttt gtgctttatc atcccctcaa tgcccgtacc      2160
     ctctacagag caggcgatcc aaccttcttt gatctcagat ttttaacttt agccactgtg      2220
     ttggggatag tctgtactgg cacctatttg ttcacaggtt caatctggcc aggaactatt      2280
     ttgcactggc ttgctgttgc aatttggttg ctgtatttag gcgggcaaga acgtctgagc      2340
     aaagtttag                                                              2349
//

If you have problems or comments...

PBIL Back to PBIL home page