(data stored in ACNUC27125 zone)

EMBL: CP000828.PE52

CP000828.PE52        Location/Qualifiers
FT   CDS_pept        complement(54650..55873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0055"
FT                   /product="leucine-rich repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25143"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:B0C531"
FT                   /protein_id="ABW25143.1"
FT                   /translation="MEKNTAYREAERLIEVARLEGVTELDLSDIGLSELPESIGSLSQL
FT                   KSLYLSENELMRLPKSLGQLTQLQTLDLARNHLPILTEVLGDLTQLRSLDLMGNALVEL
FT                   PEFIGAFSQLRSLNLVSNQLVHIPPSIGKLKNLQELQLSYNPIARWPKELGWLTGLRSL
FT                   EIASTGLNEIPPDWKSLQGLESLNLSFNHLQTLPEWLGTWTELRSLDLSFNQLKELPAT
FT                   LGSFIQLTSLDIQSNQLQSLPPQICDLVNLTSLLAYNNQLTHLPEALGGLAALTTLGMA
FT                   GNSICQLPESIGELQNLKQLIFNLDPDQPVPLQVFPAGLRGCRLLEQLTFVACELRSLP
FT                   HWIGELTQLKSLNVSHNNLTDLPPSLGTLDNLKTLNLSNNPLRSELEVLWERGPNAIKS
FT                   YLQNSAKG"
     atggaaaaaa atacggccta tcgagaggcc gaaaggctga ttgaagttgc tcgccttgaa        60
     ggggtaacgg agctagatct gagtgatatt gggttgagtg agttgccaga gtcgattggt       120
     tccctctccc aattgaaatc tctatatctc tctgaaaatg aactgatgcg gttgcccaag       180
     tctttggggc aactcactca gcttcaaacc ttggacttag cccgcaacca tctgcctatc       240
     ctgacggaag ttttgggcga tttaacccaa ttgagatccc tcgatcttat gggaaatgct       300
     ttggtggaac taccggaatt tataggtgca ttctcacagt tgcgatcgct caatttagtc       360
     tcgaaccaac tggttcatat acccccgtct atcggaaagc tgaagaacct ccaagaactg       420
     cagctttcct acaatcccat tgcccggtgg ccaaaggagt tgggatggtt gacggggttg       480
     cgatcgctag aaattgccag tactggactg aatgaaatcc cgcctgattg gaaatcgctt       540
     cagggattgg aatcattaaa cctctctttt aaccatttgc agactctgcc agagtggtta       600
     gggacatgga cagagttacg ttccttagac ttgtctttta accagctaaa ggaattaccc       660
     gcaaccctag gctcttttat ccaactcacg agtttagata ttcaatctaa tcaacttcaa       720
     tccctgcctc cacagatttg tgatttggtg aatttgacgt cgttgttggc ctataacaat       780
     cagctcaccc atcttcctga agcgttggga ggtttggctg cgttaaccac tttgggaatg       840
     gctggaaata gcatttgtca gcttccagaa tccatcggtg aattgcaaaa tcttaagcaa       900
     ctaattttta atctagatcc agaccaacct gttcctttgc aggtgtttcc cgcaggactt       960
     cggggttgtc gcctgttgga acaactgacg tttgtcgctt gtgagttaag gtcactcccc      1020
     cattggatcg gtgaactaac tcagttgaag agtctgaatg tgagccacaa caatttgact      1080
     gatctccccc cttctctcgg gacattggat aatctcaaaa cccttaatct atccaacaac      1140
     ccccttcgat cagagctaga agtgctttgg gaacggggac ctaacgccat caaaagctat      1200
     ctgcaaaata gcgcgaaggg gtaa                                             1224
//

If you have problems or comments...

PBIL Back to PBIL home page