(data stored in ACNUC8465 zone)

EMBL: CP000828.PE525

CP000828.PE525       Location/Qualifiers
FT   CDS_pept        554839..556179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0566"
FT                   /product="TRAP transporter solute receptor, TAXI family,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25616"
FT                   /db_xref="GOA:B0CD25"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD25"
FT                   /protein_id="ABW25616.1"
FT                   /translation="MGLVSTRIYVIDTIGCFERMNRGRITVSILIISLLTAGGMAVQVF
FT                   RQHRQSYVLTLATASKTGEYYQFGQALATVVARHHPQIQINVIQTEGSSQNLELIESGA
FT                   AQLALIQGDSSIQSSAQAMALLFPETAHVLVNRQAGIETMADLPGKQVALPPKGSGAYQ
FT                   LFMPIAQHYGFNTDQIRSFSSASTAYQQLKEGEVDALFQVIRPGNKALRKILRLPNIDL
FT                   IPIEQTDALRLTYPYLEDAFIPQGTYDGKIPLPFQDVKTVAVRALIIANKQVNAEVIYA
FT                   ITRVLHERKMEIVTAYPPAFTIERPESQDILGWSLHAGAEQYYTKNQPNFWVQYAELLG
FT                   LFLSLAVLGISGIWQLRLWLIGRQKNRADMYNLQLLDLIETIQETQDLEELKQVRRRLF
FT                   SILQAVVIDLDKDRISAESFQSFTMPWEVAITTLRHRETILLKVQSP"
     atgggactgg taagcactag gatctatgtc atcgatacca taggttgctt tgagcggatg        60
     aatcgggggc gtattactgt ttctatcctg atcattagcc tactgactgc tggagggatg       120
     gctgtacaag tcttccggca gcatcgtcaa agctatgttc taaccttagc aaccgcgagt       180
     aaaaccggcg aatactatca atttggccaa gcattagcaa cggttgtcgc tcgccatcat       240
     ccccaaattc agattaacgt cattcagaca gaaggctcgt cgcaaaatct ggagctgatc       300
     gaatcagggg cagcccagtt agctcttatc cagggagatt catcgattca atcatcagcg       360
     caagctatgg cgttactgtt ccctgagaca gcccatgtcc tcgtcaatag acaagcgggt       420
     attgaaacga tggcagattt gccagggaaa caagtcgctt taccacctaa agggagtggt       480
     gcttatcaat tatttatgcc gattgcccag cattatggct tcaatacgga tcagattcgc       540
     tccttttctt cagcctctac ggcctatcaa cagttaaagg aaggagaggt ggatgcttta       600
     tttcaggtaa tacgccccgg gaataaggct ttgcggaaaa tattgcgttt accaaatata       660
     gatctcatac cgattgagca aaccgatgcc cttcgcctca cttaccccta tttagaagat       720
     gcgtttattc cccaagggac ctacgacggc aagattcccc ttccctttca agatgttaaa       780
     acagtcgccg ttcgagccct aatcattgcc aataagcaag ttaatgctga agttatctat       840
     gccattactc gcgtgctcca tgagcgaaaa atggagatag tgaccgctta tccacccgct       900
     tttactattg agcggccaga atcccaagac attttaggct ggtctctcca cgctggtgca       960
     gaacagtatt acaccaagaa tcaacctaat ttttgggtgc agtatgcaga gctgttaggg      1020
     ttatttctgt ctcttgctgt actgggtatt tctgggatct ggcagcttcg tctttggtta      1080
     attggacgac aaaaaaaccg agcagatatg tataatctcc aattgctgga tttgatcgaa      1140
     actatccaag aaacccaaga tctggaagaa cttaaacagg tcagacggag attgttttca      1200
     attctgcaag ccgttgtgat tgatcttgat aaggaccgca tttcggcaga atcttttcag      1260
     tccttcacta tgccatggga agtggctatc accacgctgc gacatagaga aaccatctta      1320
     ttaaaggtgc aatctccata g                                                1341
//

If you have problems or comments...

PBIL Back to PBIL home page