(data stored in ACNUC8465 zone)

EMBL: CP000828.PE53

CP000828.PE53        Location/Qualifiers
FT   CDS_pept        complement(55937..56479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0056"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25144"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B0C532"
FT                   /protein_id="ABW25144.1"
FT                   /translation="MAIFRNAISGLIGLLLLVVIGGLILPSDVHVERNILINASPAEIF
FT                   PVVSDLSKWSAWSPWAKMDPNMALTIEGDGVGQTMHWQSEDPMVGTGTQEITAMGESSY
FT                   IQTHLDFGQQGTADAALQLAPQDNGTLVAWSLDTDVSAGVPPVMKPVSSYLRFVLESAV
FT                   GQDYEAGLSNLKALIER"
     atggctatct tcagaaatgc gatcagtgga ctgattgggc tgttgttact ggtggtgata        60
     ggcggcttga ttcttcccag tgatgtacat gttgaacgaa atattttgat caatgcttct       120
     ccagccgaaa ttttcccggt tgtcagtgat ttatctaagt ggtccgcttg gtctccctgg       180
     gcaaaaatgg accccaatat ggctttaacg attgagggtg acggcgttgg gcaaaccatg       240
     cactggcaaa gtgaggatcc gatggtggga accgggaccc aagaaatcac cgccatgggg       300
     gaatctagct atatccagac ccatttggat tttgggcaac agggaacggc tgatgcagca       360
     ttacaactgg cgcctcagga caatggtacg ctggttgcct ggtcattaga tacagatgta       420
     agtgcggggg tgcctcctgt aatgaagcct gttagttcct accttcggtt tgtcctggag       480
     agtgctgtgg ggcaagatta tgaagcgggg ttatctaacc tcaaagcatt aatagagcga       540
     tag                                                                     543
//

If you have problems or comments...

PBIL Back to PBIL home page