(data stored in ACNUC27125 zone)

EMBL: CP000828.PE535

CP000828.PE535       Location/Qualifiers
FT   CDS_pept        complement(562313..563665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0576"
FT                   /product="major facilitator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25626"
FT                   /db_xref="GOA:B0CD35"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD35"
FT                   /protein_id="ABW25626.1"
FT                   /translation="MQTFLLIWLGQVVSLLGTKLTEFALGVWVYQQNQSISQLALVILF
FT                   TYLPNTLISPIAGSLVDRWDRRWAMILSDAAAGIGTLIIGALVLTNQLEIWHIYLAVGV
FT                   NSIFNAFQVPAYTAAISQLTPASQYSRMNGMVQISRGIARVISPAIAGFLIGIVGIGGI
FT                   LIIDFSTFLIALSTLLIARFPKIVRTRPTKPPQIRRLLQEMQFAWRYITKRPGLSRLLL
FT                   FMSTNFFSVGILEVVFWPLILDFGSREELGYVLSIGGSGLLLGSIVMTAWGGPKRRVYG
FT                   LLYFIPLQAGIMLMAALQTSIPLAAMGLFVYLFAQPIIVSCNQAIWQSKVPQHYQGRVF
FT                   ALQQMIEKSLAIFAYIVVGPLVENFLEPLMAGGPFAETVGPYIGGIGEGRGIALMVLMM
FT                   GIGNLVATAMAFRSRRLRRLDVEIPTVKTLDRPVSKSEIPDAYSFEEATSP"
     atgcaaacat ttctgctgat ttggttagga caagtcgttt ccctgttagg gacaaaactg        60
     acagagtttg ccctcggagt atgggtttat caacaaaatc agtcgattag ccagctggcg       120
     ctggtgatct tgttcaccta cttgcccaat accctgatct cacccattgc ggggtccctc       180
     gtggaccgat gggaccgtcg ctgggcaatg attctcagtg atgcagcagc cggcattggc       240
     acgctgatta ttggtgccct agtcctgacg aatcagctgg agatttggca tatctacctg       300
     gcggtgggtg ttaactctat ttttaatgcc ttccaagtgc ctgcctacac ggccgccatc       360
     tctcagctaa ctccggctag ccaatatagc cgtatgaacg gcatggtcca gatttctcgc       420
     ggtatcgctc gggtgatctc acctgcgatc gcaggtttcc tgatcggcat tgtgggtatt       480
     ggcggcatct taatcatcga cttcagtacc tttttgatcg ccctctcaac cctgttaatt       540
     gcccgcttcc ccaaaatcgt tcgcacccgg ccgaccaaac cgccccaaat ccggcggctc       600
     cttcaagaaa tgcagtttgc ctggcgatat atcaccaaac gccctggttt atctcgatta       660
     ctgctcttta tgtccactaa cttcttttcc gtaggcatct tggaagttgt gttttggcca       720
     ttgattttgg attttggttc tcgggaagag cttggctatg tgctctccat cgggggcagt       780
     gggttgctac tgggcagtat tgttatgacc gcttggggcg gccctaaacg ccgggtctat       840
     ggtttgctct acttcatccc cctacaggct ggaattatgc tgatggcagc actccaaacc       900
     tccattccgc tggcggccat gggactgttt gtctacttat tcgctcaacc cattattgtt       960
     agctgcaacc aggctatttg gcagagtaaa gtcccccagc attaccaagg gcgagtattt      1020
     gcactgcaac aaatgattga aaagtctctg gcaatttttg cctatattgt cgtgggtcct      1080
     ttagtcgaga acttcctaga acccctgatg gcgggtgggc cgtttgctga aacggtaggt      1140
     ccctacattg gcggaattgg ggaaggtaga gggattgccc tgatggtgct gatgatggga      1200
     atcggtaacc tggtagccac tgctatggcg tttagaagtc gtcgcttacg ccgcttggat      1260
     gtagagattc caaccgttaa aaccctagat cgccccgtct ccaaatcgga aatccctgat      1320
     gcttatagtt ttgaagaggc aacctctcca tga                                   1353
//

If you have problems or comments...

PBIL Back to PBIL home page