(data stored in ACNUC8465 zone)

EMBL: CP000828.PE536

CP000828.PE536       Location/Qualifiers
FT   CDS_pept        complement(563666..563884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25627"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD36"
FT                   /protein_id="ABW25627.1"
FT                   /translation="MGDSLQQFEIFIPNDARVGHQPVLGNWLHQTLASWIGYGLLLPSP
FT                   IKTFRGLLKPFFPGKQPADFVAKVSRS"
     atgggggatt cactccagca gtttgaaata ttcattccaa atgatgcgcg agtcggacat        60
     caacctgttt tagggaattg gctacatcaa acattagcct cttggattgg ctatgggttg       120
     ctgctgccca gccccatcaa gacgtttagg ggcctcctga agccgttttt cccagggaaa       180
     caacctgctg attttgtcgc aaaggtgtca aggagctag                              219
//

If you have problems or comments...

PBIL Back to PBIL home page