(data stored in ACNUC5340 zone)

EMBL: CP000828.PE54

CP000828.PE54        Location/Qualifiers
FT   CDS_pept        56549..56662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0057"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25145"
FT                   /db_xref="UniProtKB/TrEMBL:B0C533"
FT                   /protein_id="ABW25145.1"
FT                   /translation="MKVVLSLKDYQSLQIIRRNKIEGHDLENSPTLGMTVG"
     ttgaaggttg ttttaagcct taaagattac caatcattac aaatcatacg cagaaataaa        60
     atagaagggc atgatttaga gaacagcccc actttgggta tgacggtggg ctaa             114
//

If you have problems or comments...

PBIL Back to PBIL home page