(data stored in ACNUC27125 zone)

EMBL: CP000828.PE546

CP000828.PE546       Location/Qualifiers
FT   CDS_pept        complement(573752..576199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0587"
FT                   /product="surface antigen variable number"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25637"
FT                   /db_xref="GOA:B0CD46"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD46"
FT                   /protein_id="ABW25637.1"
FT                   /translation="MCEVTQSPSIKILSLPPILGATVITATLLGIAPAQAKDQPSSDRD
FT                   NRQEQIRVSSPPAPSIHLGQLPTDDAPSQTAPVFPLPAQPDQPSTPAVETPSTSEEKTD
FT                   PDEATPNTGAPGDPPAADEIAPAPGAPSAADDAAPAPGDVPATDEAAPDTGAPGDVPAE
FT                   TPSADDVPPTESPAAPNPGLPVPGGDIPSGNPGDTQTPSPDSSVESPGSPPQPPTETAE
FT                   PPAAPEPEVLVSEVLVEGVDGDLAINAYEAISTRPGQTTTRSQIQSDINAIFGTGFFSN
FT                   VRAEPSDTPLGVRVTFFVQPNPTLQSVQVAGNQVLTQEKVDEIFQSQYGKILNLRDLQA
FT                   GVTRVNKYYQDEGFVLGQVVGVPQVDPDGTVTLQVAEGVVEDIDVRYINEDGEPTKGKT
FT                   RKFIITREMRTEPGLPLNRNKLQTDLQRVFGLGLFEDVKVALEPGQDPRKVVVNLNVQE
FT                   RSTASFSAGAGFSSRSGFFGTGSFTQNNLGGNNQTLSVQAQAGTREFLFDAGFSDPWIA
FT                   GDPNHSSYSINIFNRLTLPLVFDEGPIEVDLPNGDTPRVNRLGISGVFNRPFTTDLDNL
FT                   RQAWTGSIGFRYQRISIRDSDFSISPVDELGNALSFSGTGNDDLLTVQLGIGRDLRDDP
FT                   ADPTKGYALRFGLEQSAPIGSGSILLTRLRGSFSYFVPIKLTNFTEGPQALAFNVQAGT
FT                   VLGDLPPYEAFSLGGSSSVRGYGEGDLGSGRSFMQATAEYRFPLINFLGGVGAVLFFDV
FT                   GSNLGTQSNVPGQPGIVRGKPGVGFGYGIGVRVKTPIGPVRLDYGINDDGDNQFHFGFG
FT                   QRF"
     gtgtgtgaag tgactcaatc tccatcgatc aagattctca gtcttccacc gattctcggt        60
     gcaaccgtga tcacggcgac cctgctgggc attgcacccg cccaagccaa agaccagcct       120
     tcttcggaca gagataatcg ccaagaacag atcagagtat cctccccccc tgccccctca       180
     atacaccttg ggcagctgcc gacagatgac gcccctagtc aaactgcccc ggtttttccc       240
     ctccctgctc aacccgatca accctccacg ccagcggtag aaaccccgtc cacatcggaa       300
     gagaagactg atccagacga ggccacccca aatacgggag caccaggaga tccccccgca       360
     gcagacgaga tcgccccagc ccccggagcc ccctccgcag cagatgacgc cgctccggcc       420
     ccaggagatg taccagcgac ggacgaagcg gccccagata caggtgcccc aggagatgta       480
     ccagccgaaa cgccctctgc cgatgacgtc ccccccacag aatcgccagc ggcccccaat       540
     cctggacttc cggttcccgg cggcgatatt cccagcggca atcctggcga cacgcaaacc       600
     ccgtctcccg atagttcggt agaatctccg ggttcccctc ctcaaccccc cacagaaacg       660
     gctgaaccac ccgcagcccc tgaaccagag gttttggtct cagaagtctt agttgaaggg       720
     gtcgatggcg atttagcgat taatgcctat gaagccatta gtacccgacc aggccaaaca       780
     acaacgcgat cgcaaattca atccgacatt aatgccattt tcggcactgg cttttttagc       840
     aatgttaggg cagagcccag tgatacaccc cttggcgtca gagtcacctt ctttgtccag       900
     cccaatccca ccctccaatc cgtgcaggtg gctggcaatc aggttctcac ccaagagaaa       960
     gtggatgaga ttttccaatc ccaatacggc aaaatcctta accttcggga tctccaagca      1020
     ggggtgactc gggtcaataa atattatcaa gatgaaggtt tcgttctcgg tcaagtggtg      1080
     ggcgttcccc aagtggatcc cgatggcact gtcaccctcc aggtggcaga aggggtcgtt      1140
     gaagatatcg atgttcgtta cattaacgaa gatggagagc ccaccaaagg caagactcgg      1200
     aaatttatta ttacccgaga aatgcgcacc gagccgggtt tgcctttaaa ccgcaacaag      1260
     ctgcaaaccg acctacagcg cgtgtttggg ttggggctgt ttgaagatgt caaagtggcc      1320
     ctcgaaccgg gtcaggatcc acggaaagtc gtggtgaatc taaatgtgca ggaacgaagc      1380
     acggccagct tctccgctgg tgctggtttt agctctcgaa gtggtttctt tggcaccggc      1440
     tcctttactc agaataattt agggggcaac aaccaaaccc tgagcgtcca agcccaggct      1500
     ggaacccgag aattcttatt tgatgccgga ttttcggatc catggattgc cggagatccc      1560
     aaccattcct cctacagcat caacatcttc aaccgcctga cccttcccct cgtgtttgat      1620
     gaaggcccga ttgaagtcga tctgcccaat ggggatactc ccagggtcaa ccgattgggg      1680
     attagtggtg tgtttaaccg ccccttcacg acagacctag ataacctcag acaagcctgg      1740
     actggatcga ttggcttccg ataccaacgg atttcaattc gcgacagtga cttctcaatt      1800
     tctcctgtgg acgaattggg caatgcctta agttttagcg ggacgggcaa tgatgaccta      1860
     ctcaccgtcc aactcggcat tggccgtgat ttacgggatg atccagccga ccccaccaag      1920
     ggatatgccc tacgatttgg cctagaacaa tcggctccca ttggctctgg cagcatccta      1980
     ttaacgcgac tccgggggag ctttagctat ttcgtcccta tcaaactcac caactttacc      2040
     gaaggtcccc aagccttggc ctttaatgtc caagctggaa cggtcctagg ggacctacct      2100
     ccctatgaag ccttctccct cgggggcagc tcttcggtcc ggggctacgg agaaggagat      2160
     ttgggcagtg gtcgcagctt tatgcaggcc accgctgaat atcgttttcc gttgattaac      2220
     ttcttggggg gtgtgggtgc tgtcctcttc tttgatgtgg ggagtaacct gggaactcaa      2280
     agtaatgttc cgggtcaacc tggtattgtt cgcggcaagc ctggggttgg ctttggctac      2340
     ggcattgggg tacgcgtcaa aacgcctatt ggtccagtcc gactggatta tggcatcaat      2400
     gacgatgggg acaatcaatt ccactttggc tttggtcaac gattctaa                   2448
//

If you have problems or comments...

PBIL Back to PBIL home page