(data stored in ACNUC8465 zone)

EMBL: CP000828.PE548

CP000828.PE548       Location/Qualifiers
FT   CDS_pept        complement(577131..577541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0589"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25639"
FT                   /db_xref="InterPro:IPR014953"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD48"
FT                   /protein_id="ABW25639.1"
FT                   /translation="MSPSPTVQQSQAALAKFAALDPPPITTAEEREQAKTDLLALAQAT
FT                   DYQMFGILAETCDQAIAALTAYSQAFGYEMPTNWQPITGPTYLKFNPNLGSCYTDNYVG
FT                   NHRGVLISFQSESEEIINQTYGHFPLDLFSNP"
     atgtcccctt cccccaccgt ccaacaatct caagcggccc ttgccaaatt tgcagccctg        60
     gatcctccgc ctattaccac ggctgaggaa cgagaacagg ctaagaccga tttattagcg       120
     ttggcccagg ccacggatta ccaaatgttc ggcatcttgg cggaaacctg tgatcaagcg       180
     atagctgcct taacggccta cagccaagcg tttggctatg aaatgccgac gaattggcag       240
     cccattaccg gccccactta cctgaagttc aaccccaact taggcagttg ctataccgat       300
     aactatgtgg ggaaccatcg tggcgtgctg atctcgttcc aatctgaatc agaagaaatt       360
     atcaaccaga cctatggtca tttcccgctg gatttattct ctaatccttg a                411
//

If you have problems or comments...

PBIL Back to PBIL home page