(data stored in ACNUC27125 zone)

EMBL: CP000828.PE55

CP000828.PE55        Location/Qualifiers
FT   CDS_pept        56869..57216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0058"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25146"
FT                   /db_xref="UniProtKB/TrEMBL:B0C534"
FT                   /protein_id="ABW25146.1"
FT                   /translation="MTRQIKMIAGLLATTSVAGLVVAAFPQISLAGQKHTYDPILVQRY
FT                   NSGCVEKVTGKGYSPAQAKQMCSCSMSNMQTQLTENQAISLLIKSQFSFSKDKDTGLPT
FT                   SLSPYFVGCKA"
     atgactcgcc aaatcaaaat gattgctggt ttgctcgcca ctacaagcgt cgctggatta        60
     gtggttgccg ctttccctca aatttccctg gctggtcaaa agcacactta cgaccccatt       120
     ttggttcaac gctataactc tggctgcgtc gagaaagtaa ctggtaaagg ttattctcct       180
     gcccaagcta agcaaatgtg cagctgctcc atgagcaata tgcaaaccca gctcactgaa       240
     aatcaagcta ttagcctact gattaaatct cagttcagct tctccaagga taaggacact       300
     ggactaccta cttccctttc tccttacttc gtgggctgca aagcctaa                    348
//

If you have problems or comments...

PBIL Back to PBIL home page