(data stored in ACNUC5340 zone)

EMBL: CP000828.PE552

CP000828.PE552       Location/Qualifiers
FT   CDS_pept        complement(579654..581450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0593"
FT                   /product="TrkA-C domain protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25643"
FT                   /db_xref="GOA:B0CD52"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD52"
FT                   /protein_id="ABW25643.1"
FT                   /translation="MEPIFQTLLVTGLTLLCFVFEWLPPDLTAICVMVVLMLLGLVTTA
FT                   EGLSGFSNPATITVMAMFILSSGIARTGAIQMASEFLLKWGGKRPARHMLIMGAVIGPF
FT                   TAIINNVAIVSVFLPVVEDWSRQRRIPVSKLMIPLSYITILGGMITVLGTSTSVLASGL
FT                   SSDLGLGSFDIFQFTALSLCTFTAGLVYMATIGHRLLPNRKTSSSLSQGYGLKDYVSEV
FT                   VITPQSGLVGQTVQSSLIQRIYDVDILELIHDDNHFPQPLADKTLSAGDILLVRGGRED
FT                   LLKIRDGQGLEILPDVQFGQKSWQADLSAEEGAAEAMVLADSNLIGSTLKDLRFRQRYN
FT                   CTVLAIRRGQELVRDRLGKVRLRFGDLLLVQGPKQSLVGLQTSKDLLVMEQRDVENLRR
FT                   DKAWIAIAIGLLVVGVAGTKRFSIAVTALAGVMLMVLTGCLKPGELYRAVRWDVVFLLA
FT                   GLFPLGIAMKKSGATQLLADQLISVGGQLSGYWLLTLFFVLTALLTEILSNNATVILLL
FT                   PVAVQVAQELGYNPFAFMFVVTFAASNSFMTPIGYQTNTMVYGTGGYRFLDFLRVGGPL
FT                   SLLMALITPPLIILLYGLQPLS"
     atggagccaa tttttcagac ccttttggtg acaggactga cattactctg ttttgtattt        60
     gaatggttac ctccagatct gacagcaatc tgcgttatgg tcgtcctcat gctgctggga       120
     ctcgtcacca cagcagaagg gttatcagga ttcagtaatc ccgccaccat caccgtaatg       180
     gccatgttta ttcttagttc aggcattgcc cggactggag ccattcaaat ggccagcgaa       240
     tttttgctca aatggggagg taaacgcccc gcccgacaca tgctgattat gggggctgtc       300
     atcgggccat ttacggccat cattaacaat gtcgcgattg tctccgtttt cctacccgtt       360
     gtcgaagatt ggagtcgcca acgccgcatt ccagtatcca aattgatgat tcccctgtct       420
     tacatcacaa ttttgggggg catgattacc gttctgggca cctctaccag cgtattggcc       480
     agtggcttat cgtctgacct aggcttaggc tcttttgata ttttccaatt tacggccctg       540
     agtttatgta cgtttaccgc tgggctcgtg tacatggcca cgattggcca tcgtttgtta       600
     cctaatcgga agacctcttc cagtctgagc caagggtatg gcctgaagga ctatgtcagt       660
     gaagtggtga ttacccctca gtcaggtttg gtggggcaaa ccgttcagtc gagtttgatc       720
     cagcgaattt atgacgttga cattttggag ttgatccatg atgacaacca tttccctcag       780
     cccctagcgg acaaaaccct gtcagctggc gatattttgc tcgtgcgtgg gggacgggaa       840
     gatctgttaa aaattcggga tggccagggt ctagaaattc tgccagatgt gcaatttggc       900
     caaaaatcct ggcaagccga tttaagtgca gaagaagggg cagctgaagc catggtactg       960
     gcggattcca acctgattgg ttcgaccctt aaagatttgc ggtttcgcca acgttacaac      1020
     tgtacggtgt tggcgattcg acgggggcaa gagttagtcc gagatcggtt aggaaaggta      1080
     cgactccgat ttggtgactt gctattggtg caaggaccga agcaaagttt agtgggtttg      1140
     cagaccagca aagacctatt ggttatggaa cagcgggatg ttgagaacct gcgccgggac      1200
     aaagcgtgga ttgcgatcgc aattggtctc ctggtcgtgg gggtcgccgg caccaaacgg      1260
     ttttccattg ccgtcacggc cttagctggg gtgatgctaa tggtcttgac gggctgtcta      1320
     aaaccaggtg aactctatcg agcggttcgt tgggatgtgg tattcctgct cgcgggctta      1380
     ttccccttag gcattgccat gaaaaagtct ggcgccaccc aactgttagc ggatcaatta      1440
     atttcggtgg ggggacaatt atccggctat tggctgctca cgctgttttt tgtcctcacg      1500
     gcactgctga cggagattct ctccaacaac gccacggtta ttttgctatt gcctgtggca      1560
     gtccaagttg cccaagagct aggctacaac ccctttgcct ttatgtttgt cgtcacgttt      1620
     gcagcctcga acagctttat gaccccgatt ggttatcaaa ccaacacaat ggtctacgga      1680
     acgggagggt atcgcttcct cgattttctg cgagtgggcg gccccttaag tctgctcatg      1740
     gcgctcatta ctccgccgct gattattctg ctctatggtt tacagcctct ttcctga         1797
//

If you have problems or comments...

PBIL Back to PBIL home page