(data stored in ACNUC8465 zone)

EMBL: CP000828.PE559

CP000828.PE559       Location/Qualifiers
FT   CDS_pept        complement(588237..589340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0600"
FT                   /product="TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25650"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD59"
FT                   /protein_id="ABW25650.1"
FT                   /translation="MLSMRLLSTSILLILGVGVIIPEQVNSPVHAEPIAQVNKDRQLFQ
FT                   LFKKGKELVEANDLDMALQAYRQATLLDTKNPRIFSAIGYIQAQRKDFARSVEAYKKAI
FT                   ALDGKNANFHYALGYSLGNLGQNDQAAAAYQKVIELEPKNVRAYEGLAVIYSRQQKYDE
FT                   AFQNFQKVIEINPKNGGAYNSIGLIHLKRNQVEPAVTNLEKAATLSPKNGEIQMNLALA
FT                   YAAQGKTEEGLVALDKAVKLDPRNPKVHLRTGQLLQSQGNNERAITAYKQALRHDKNLG
FT                   AAHEGLGDVLMQKGDALGAVVAFRQATKLEKRNPSAFYKLAKALIARNRHREAIPELHK
FT                   ARQLYQLQRQADGVKKVDTLLKQLSVS"
     atgttaagca tgcgcttact aagcaccagt attttgttga ttctgggggt tggagtcatc        60
     attcctgaac aggtaaacag cccggttcac gctgagccta tcgcccaggt caataaagat       120
     cgccaactct ttcagctatt taagaaaggt aaagagttag tggaggccaa tgatttagat       180
     atggccttgc aagcgtatcg gcaagccact cttttagata ccaaaaaccc acgcatattc       240
     tcagcgattg gctatattca ggctcaaaga aaggattttg cgagatcagt cgaagcctat       300
     aaaaaagcga tcgcattaga tggcaaaaat gccaatttcc actatgcctt ggggtatagc       360
     ttgggtaact tgggccaaaa tgaccaagct gcggcagctt atcaaaaagt aattgaattg       420
     gaacccaaaa atgttcgggc ctatgaaggc ctagcggtca tttacagtcg tcaacagaaa       480
     tatgacgagg cctttcaaaa ctttcaaaaa gtcatcgaga ttaaccccaa gaatggtgga       540
     gcctacaact cgattggcct gatccactta aaaaggaatc aggtagagcc cgccgttact       600
     aatttggaaa aagccgccac cctctctccc aaaaatggcg aaattcagat gaatctggct       660
     ttggcctatg ccgcccaagg taaaacggaa gaaggattag tagccctaga taaagcggtc       720
     aaattagatc caagaaaccc taaggtccat ttgcggacgg gacagctatt gcagagccag       780
     ggcaacaacg agcgggctat aacagcctat aaacaggcct tgcggcatga caagaattta       840
     ggggcagccc acgaaggtct gggggatgtc ttgatgcaaa aaggggatgc attaggggct       900
     gtggttgcct ttcgccaagc cactaagcta gaaaagcgta accctagcgc cttttataaa       960
     ttagccaaag cgctgattgc ccgaaaccgc catcgggaag ccattcctga attacacaag      1020
     gctcgccagc tataccagct tcagcgccaa gccgatgggg tcaaaaaagt ggataccctc      1080
     ttgaaacagt tatcggtcag ttaa                                             1104
//

If you have problems or comments...

PBIL Back to PBIL home page