(data stored in ACNUC8465 zone)

EMBL: CP000828.PE56

CP000828.PE56        Location/Qualifiers
FT   CDS_pept        57306..57686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25147"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:B0C535"
FT                   /protein_id="ABW25147.1"
FT                   /translation="MAYPLSATKLQTYRQCPQAYYFKHERRLTVPTAFGSPTFGKAIHR
FT                   ALAQIYQDWSYADPIPPLQWFADCWQQHIGELSESQIHEGWQALETYYRQYVAPQSMLR
FT                   KPLGIEGKIQASFQVSKALLHE"
     atggcctacc cactgtcagc gactaagctt cagacctatc gtcaatgtcc tcaagcctat        60
     tatttcaagc atgagcggcg gttaacggtc cccacggctt tcggttcacc cacctttggt       120
     aaagcaatcc atcgggcttt ggcccaaatt taccaagact ggtcctatgc cgaccccatt       180
     ccgcccctgc aatggtttgc cgactgttgg caacagcata tcggcgaact cagtgagtcc       240
     caaattcatg aaggctggca agccctggag acttactatc gccaatatgt ggctcctcaa       300
     tcgatgttgc gaaaaccttt gggcattgag ggcaagattc aagcctcttt tcaggtcagt       360
     aaggcgttgt tgcatgaata g                                                 381
//

If you have problems or comments...

PBIL Back to PBIL home page