(data stored in ACNUC5340 zone)

EMBL: CP000828.PE570

CP000828.PE570       Location/Qualifiers
FT   CDS_pept        complement(601826..602608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0611"
FT                   /product="putative membrane protein DUF990"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25661"
FT                   /db_xref="GOA:B0CD70"
FT                   /db_xref="InterPro:IPR010390"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD70"
FT                   /protein_id="ABW25661.1"
FT                   /translation="MKRYFRVLKLFWATTIAAEMEYRSNFAISALSSLGNLAGSLFGLS
FT                   LFYRTGYTFQDWSWHEALVVLGVFTLLQGFSATCLVPNLNRIVRHVQEGTLDFILLKPI
FT                   SSQFWLSTYSVSPWGLPDVLFGLGLIGYAGFQLGLGWQNYALGLWPLLCGFLSLYSLWF
FT                   VLGATSIWFVKIYNVTEVLRGLVEAGRYPVVAYPTAYRFFFTFVIPVTFLTTVPAQAML
FT                   NRATWNWSLGAGILAIALFILSNRFWQFALRFYTSASS"
     atgaagcggt attttcgggt gctgaagctg ttttgggcaa cgaccattgc agcagagatg        60
     gaatatcgct ccaactttgc aatctcggcc cttagcagcc ttggtaatct cgcgggtagc       120
     ttatttggcc tatctttgtt ttatcgtaca ggctatacct tccaagactg gagttggcat       180
     gaagccctcg ttgttttggg tgtcttcacc ctcctccaag gcttttcagc cacctgcctt       240
     gtcccaaatc taaaccgaat tgttcgccac gttcaagaag gcacccttga ttttattctg       300
     ctcaaaccta tcagcagtca attttggtta tccacttatt ctgtctctcc ttggggtctg       360
     cccgatgtcc tttttggcct agggctgatc ggctatgccg gatttcaact gggactaggc       420
     tggcaaaatt atgcccttgg tctatggcca ctgctgtgcg gatttctcag cctctatagt       480
     ctctggtttg ttttgggagc caccagtatt tggtttgtca aaatctataa cgtcacagaa       540
     gtcctgcggg ggctggtcga agctggccgc tatccggtcg tagcctatcc aaccgcctat       600
     cgcttctttt ttacctttgt gatacccgta acattcctaa ctacagtgcc cgctcaagcc       660
     atgcttaatc gagccacctg gaattggagc ctaggggcag gtatactcgc aatcgcccta       720
     tttatactgt ccaatcggtt ttggcaattc gcacttcgtt tctacaccag tgcatccagc       780
     tag                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page