(data stored in ACNUC27125 zone)

EMBL: CP000828.PE579

CP000828.PE579       Location/Qualifiers
FT   CDS_pept        complement(608822..609526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0621"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0621"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25670"
FT                   /db_xref="GOA:B0CD79"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD79"
FT                   /protein_id="ABW25670.1"
FT                   /translation="MEAILMVLAGLLLGIFATVAILYAFLVVLVLPNRESISTFQQHSF
FT                   QQHSSQPQRLTTEVRELSDLQALMEIRQPQPVEAQSWHQDSEYLALKADIQAESQAYQR
FT                   IPTFLRGFMPKPWKKAWQYSESLTYVNDSIPKILGNWDSREFSRQCTPTLLKSTQKDSL
FT                   DQSFADLLGRCGQMTAYQGIKYFGLDNLRGDSVWQFVAQADFENGWAIITGRVIWQGQR
FT                   CWFDHFSISNAI"
     atggaagcaa ttttaatggt tctagctgga ttgctattgg gtatttttgc caccgtagca        60
     attctctatg ccttcttggt ggtcctagtt ttaccaaata gagaatctat ctctactttt       120
     caacaacact catttcaaca gcactcttct caaccacaac gactcacgac tgaagtgcgt       180
     gaactcagtg atttacaagc tttgatggaa attagacagc cccagcctgt cgaagcccaa       240
     tcttggcatc aagattctga atatctcgct ttaaaagcag atatacaagc tgaatcgcaa       300
     gcttaccagc gtattcccac ttttctcaga gggtttatgc ccaaaccttg gaaaaaagct       360
     tggcagtaca gcgaatcatt aacctatgtg aatgattcaa ttcccaaaat tcttggaaat       420
     tgggatagtc gagaattctc tcgtcaatgt actcctacgt tattgaagtc aactcaaaag       480
     gacagcttag atcaaagctt tgccgattta ctgggtcgat gtggccagat gacagcttat       540
     cagggcatca aatactttgg attggataac ctaagaggcg attcggtctg gcaatttgtg       600
     gctcaagctg acttcgagaa tggatgggcg attataaccg gacgtgtgat ttggcaagga       660
     cagcgctgtt ggttcgatca cttcagtatt agcaacgcca tatag                       705
//

If you have problems or comments...

PBIL Back to PBIL home page