(data stored in ACNUC8465 zone)

EMBL: CP000828.PE581

CP000828.PE581       Location/Qualifiers
FT   CDS_pept        611563..611748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25672"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD81"
FT                   /protein_id="ABW25672.1"
FT                   /translation="MKDDVVEAAHERQRLSVLHKQLIISLKFHHSQTLEQIPVEMAVQA
FT                   MIEVWQACNPSQSPKD"
     atgaaagatg acgtcgtcga ggctgcccat gaacgtcagc gcctctcggt tttacacaag        60
     caactgatta tcagcttaaa atttcatcac agccaaactc tggaacaaat tcctgtggag       120
     atggcagttc aagccatgat tgaagtatgg caagcctgca atccatccca atctcctaaa       180
     gattag                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page