(data stored in ACNUC27125 zone)

EMBL: CP000828.PE585

CP000828.PE585       Location/Qualifiers
FT   CDS_pept        615097..615495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0627"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25676"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD85"
FT                   /protein_id="ABW25676.1"
FT                   /translation="MVRYRQLLASEDPAWTYVSGKLRSGYGVASGRGVDSPYPEGTIAL
FT                   QTPYFKELGLDLTPYYPGTLNILIAPAQFQMIQPQWTFPLVHWYPASCPETFSFSPCQV
FT                   KSGDHLASGLIYYPHPETKPEHFQDPNY"
     atggtcaggt atcgtcagtt gttagcatca gaagacccag cctggaccta tgtgtctgga        60
     aaactgcgct caggctatgg tgtagcgtct ggacgagggg ttgactctcc ttatcctgaa       120
     gggacgattg cattacaaac accttatttc aaagaattag gattagacct aaccccctat       180
     tatcctggca ctctgaatat tttgattgct cccgctcagt tccagatgat tcagccccaa       240
     tggacgtttc ccctggtgca ttggtatcca gcatcttgcc ctgaaacctt ttccttctcc       300
     ccctgtcaag tgaagtctgg cgaccacctt gcttcaggac tgatttacta tccccaccct       360
     gaaacgaagc cggaacattt tcaggacccc aattattga                              399
//

If you have problems or comments...

PBIL Back to PBIL home page