(data stored in ACNUC8465 zone)

EMBL: CP000828.PE589

CP000828.PE589       Location/Qualifiers
FT   CDS_pept        complement(618508..618705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0631"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25680"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD89"
FT                   /protein_id="ABW25680.1"
FT                   /translation="MGERTCLKIAEIPFFDLTSFLISPLTEVLILTPLTSTQSSNLLLG
FT                   PDPIEPSGPFVIQATYLLRI"
     atgggagaac gaacctgtct caaaatcgct gaaataccgt tttttgatct gacttcgttt        60
     ttaatcagcc ccttaacaga agtcctaatt ctcaccccac tgactagcac ccagtcatcc       120
     aatctactcc taggcccgga ccctattgaa ccctctggac cgttcgttat acaagcaact       180
     tatttgctaa ggatttga                                                     198
//

If you have problems or comments...

PBIL Back to PBIL home page