(data stored in ACNUC27125 zone)

EMBL: CP000828.PE59

CP000828.PE59        Location/Qualifiers
FT   CDS_pept        59402..60259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0062"
FT                   /product="integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25150"
FT                   /db_xref="GOA:B0BYN1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B0BYN1"
FT                   /protein_id="ABW25150.1"
FT                   /translation="MVRQLQQDYSIRQICQVLNYPRSQVYYHARGQPDESELKAAIAGV
FT                   AGAYPTYGYRRITAQLQRQGYCVNHKRVARLMRQIGIMAKTKVKRKRTTNSEHSFPRYG
FT                   NRVLNLSIDHPEQVWVADITYIRLQQEFVYLAVVMDVFTRAIRGWHLSRHIDQQLTLRA
FT                   LNKALERATPEIHHSDQGVQYAAAAYMQLLQQHQVQISMAEVGQAWQNGYAERLMRTIK
FT                   EEEVDLSDYRNFTEAYEHIEQFLEDVYMHKRIHSSLGYLTPCEYEQQWRQQNNHYCMNK
FT                   EDSA"
     atggtgagac agttgcagca ggactattcc attcgccaaa tttgtcaggt actcaattac        60
     ccacgctctc aagtgtatta ccatgccaga ggccaaccgg atgagagcga actaaaagcg       120
     gccattgctg gagttgctgg agcctatccg acttatggct atcgtcgaat caccgcccaa       180
     ctgcagcgtc aggggtattg cgttaaccat aaacgcgtgg ctcgactaat gcgacagata       240
     gggattatgg ccaagaccaa agtcaaacgc aaacgcacca ccaatagcga acattcgttc       300
     cctcgctatg gcaatcgagt gttgaatctc tccatcgacc atcctgagca ggtgtgggtg       360
     gcggacatca cgtacattcg cttacagcag gagtttgtct atttggccgt cgtgatggat       420
     gtctttactc gcgccattcg tggctggcat ctgtcccgcc atatcgacca gcaactaacg       480
     ttgagggcgt tgaacaaggc gttggagcgg gcaacgcctg agattcacca ttctgaccaa       540
     ggggttcagt atgccgctgc agcctatatg caattgctcc aacaacacca agtgcaaatc       600
     agtatggccg aggtgggaca ggcttggcaa aatggctatg ctgagcgatt gatgagaacg       660
     ataaaagaag aagaggtcga tttatcagac tatcgaaatt ttactgaagc gtatgagcac       720
     attgagcagt ttctagaaga tgtgtatatg cataagcgga ttcattcatc actggggtat       780
     ttgacaccct gtgaatatga gcagcagtgg agacaacaga acaatcacta ttgtatgaat       840
     aaggaggata gcgcttaa                                                     858
//

If you have problems or comments...

PBIL Back to PBIL home page