(data stored in ACNUC27125 zone)

EMBL: CP000828.PE592

CP000828.PE592       Location/Qualifiers
FT   CDS_pept        620835..621383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0634"
FT                   /product="heme NO binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25683"
FT                   /db_xref="GOA:B0CD92"
FT                   /db_xref="InterPro:IPR011644"
FT                   /db_xref="InterPro:IPR024096"
FT                   /db_xref="InterPro:IPR038158"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD92"
FT                   /protein_id="ABW25683.1"
FT                   /translation="MYGLVNKAIQEMVCDHFGEDAWKAIRELSETKSENFISLESYPDD
FT                   LTHRLVKSASQVLGISAAEIMEDFGKYWVKFTGQEGYGEMMDLAGDDLPEFLGNLDDLH
FT                   SRLGVIFPKMQPPSFQCSDQEKQTLNLHYYSHRKGMAPMVSGLVEGLGERFDTAVEVTQ
FT                   VQDREQGADHDVFSVTYQP"
     atgtatggct tagtgaataa agccattcaa gaaatggttt gtgaccattt tggtgaggat        60
     gcttggaaag cgatcagaga actttccgaa actaaatctg aaaattttat tagcttggag       120
     agctatcctg acgacttgac ccatcgtttg gtcaagtctg ccagtcaagt gctgggaatt       180
     tctgcagccg agatcatgga agattttggg aaatattggg taaagtttac tggacaagaa       240
     gggtatggcg aaatgatgga cctggctggt gatgatttgc cagagttttt gggaaatctc       300
     gatgacttac atagccgtct aggggtaatt ttcccaaaaa tgcaaccgcc ttcctttcaa       360
     tgtagtgatc aggagaaaca gaccttaaac ctgcattact attcccatcg aaaaggaatg       420
     gctccgatgg tatctggatt ggtggaaggg ctaggggagc gatttgacac agcagtagaa       480
     gtaacccaag tccaagatcg agagcaggga gctgatcacg atgtgttctc agtcacctat       540
     cagccctag                                                               549
//

If you have problems or comments...

PBIL Back to PBIL home page