(data stored in ACNUC27125 zone)

EMBL: CP000828.PE593

CP000828.PE593       Location/Qualifiers
FT   CDS_pept        621355..623316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="AM1_0635"
FT                   /product="two-component hybrid sensor and regulator
FT                   histidine kinase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:AM1_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ABW25684"
FT                   /db_xref="GOA:B0CD93"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011645"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042463"
FT                   /db_xref="UniProtKB/TrEMBL:B0CD93"
FT                   /protein_id="ABW25684.1"
FT                   /translation="MCSQSPISPSHQTLFFRHSLPPGQFATAFPFHFVLNSDLEIIQAG
FT                   DSLQHLLPKICGSQFEQQFAIQRPPLSPDFASLSEPCRSLLILDCLAINMQLQGQMVYV
FT                   VETNLIFFLGSLWVTEIHELKPLGLRLNHFAVHDRVSDFLFLLQAKNTALNEAHKLADE
FT                   RAQKLVAAKEMAESANLAKSTFLANMSHELRTPLNAILGFSQLLSRDSTLTAAHLHKLS
FT                   IINNSGEHLLALLNDILEMSKIEAGQITLDPTNFNLHHFLEGLYNLFQQKVFSKKINLK
FT                   FQYSKTVPQYIQADIKKLRQVLINLLGNAIKFTNEGQVYLKVASRIYLDDAYSVNLQEP
FT                   TCLLTFSVEDTGPGVSEEDQEKIFHPFYQTEYGKQSHQGVHGTGLGLSISRQFVNLMGG
FT                   ELSISSQLNKGATFSFSIPVKVSTASALVPTLEQRILQVHPHQPIFRILVVEDHADNRC
FT                   LLVTLLATIGFLVKSAQNGQEALEICQEWHPHLIWMDIKMPLMDGLEATQRIRAMPQIP
FT                   QPVIIALTANAFDEDKERALTCGCDDFLHKPCNETIILEKMTQHLGVKYLYEELTPPLT
FT                   HCDSLSLPKRNDLKAQLQEVMSESWLNHLQSKAINLDTDGIFDLLEDISPEYEHLKNLL
FT                   ASLANNYRCDVILELTQQ"
     atgtgttctc agtcacctat cagccctagt catcagactc ttttctttcg gcatagttta        60
     ccgccagggc aatttgccac tgccttccca ttccatttcg ttctcaattc agatttagag       120
     attattcaag ctggagactc tcttcagcat ttactcccta aaatctgtgg gagtcagttt       180
     gaacagcaat ttgcgattca aagaccccct ttgtcaccag attttgctag tctcagcgag       240
     ccttgccgtt cgttgttgat tttagattgc cttgctataa atatgcagtt gcaagggcag       300
     atggtgtatg ttgtcgagac taatttaatt ttcttcctcg gctctctctg ggtaacagaa       360
     atccatgagc ttaaacctct ggggttacgg cttaaccatt ttgctgttca tgatcgggtc       420
     tcagattttc tgtttctttt acaggccaaa aatacagctt taaatgaagc ccataagttg       480
     gcggatgaac gggctcaaaa attagtggct gctaaggaga tggctgaaag tgcgaattta       540
     gctaaaagca cctttcttgc caatatgagt catgaattgc gaacacctct aaatgcaatt       600
     ttaggctttt cgcaactatt gagtcgggat tcaacattga cggcggctca tcttcataag       660
     ctaagcatca tcaataatag tggtgaacat ctcctggctc ttctcaacga cattttagaa       720
     atgtcgaaaa ttgaggctgg tcaaattact ctagatccca ccaatttcaa ccttcatcac       780
     tttttggaag gcctatataa tttgttccag cagaaggttt tttccaagaa aattaattta       840
     aagtttcaat attctaaaac ggttccccaa tatattcaag ctgatatcaa aaagcttcgt       900
     caagtactaa ttaatttact agggaatgca attaaattta ctaatgaagg gcaagtttat       960
     ctgaaagtag ccagtcgtat ttatctcgat gatgcttact ctgtaaacct tcaggagccg      1020
     acttgtttat taaccttctc agtagaggat acggggcctg gtgtctcgga agaggatcaa      1080
     gagaagattt ttcatccttt ttaccaaact gagtatggca aacagtccca tcagggggtt      1140
     catgggacag gcttaggact gtcaattagt cgtcaatttg tcaatttaat ggggggagaa      1200
     ctatccatat cgagtcaact gaataaggga gcgacttttt ctttttcaat tcccgttaaa      1260
     gtaagtactg ccagtgcatt ggtacccacc ctcgaacagc gtattcttca ggttcaccct      1320
     catcaaccga tttttcggat cttggtagtg gaagatcatg cagataatcg atgtttgtta      1380
     gtcacattac tggccaccat tggctttttg gtgaaatctg cacaaaacgg ccaagaagct      1440
     ttggaaattt gccaagagtg gcatccccat ttaatttgga tggatattaa gatgccttta      1500
     atggatggcc tggaggcgac tcaacggatt agagcaatgc ctcagatccc acaaccagtg      1560
     attattgctt taacggctaa tgccttcgat gaagataaag aacgagccct gacgtgtggc      1620
     tgtgatgatt ttctccataa accctgtaat gagacgatta tcttggagaa aatgacgcag      1680
     catttagggg tgaagtattt atatgaagaa ttgactcctc cgttgaccca ttgcgactct      1740
     ttgtccctac ctaaacggaa tgatcttaag gctcaattgc aggaagtgat gtctgaatca      1800
     tggctgaacc atttgcagag taaggccatt aatttagata cggatggaat ttttgacttg      1860
     ctagaagaca tctcacctga atatgagcat ttaaaaaacc ttttggcctc cctggccaat      1920
     aattatcgat gtgatgtaat cctggaattg actcagcaat aa                         1962
//

If you have problems or comments...

PBIL Back to PBIL home page